{"uniprot":"A0A0B4J2E0","gene":"TRBV12-4","name":"T cell receptor beta variable 12-4","organism":"Homo sapiens (Human)","status":"dark","length":115,"sequence":"MGSWTLCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL","function_summary":"A variable immunoglobulin-like binding module from a human T-cell receptor beta chain that forms a high-specificity recognition surface for peptide–MHC ligands at the cell surface. By pairing with the alpha chain, it captures extracellular peptide–MHC and nucleates receptor–CD3 assemblies that initiate intracellular signaling cascades controlling lymphocyte activation and broader immune responses. Its beta-sandwich architecture enforces selective protein binding rather than catalysis, and its physiological action occurs at the plasma membrane where antigen surveillance is executed.","plain_language":"TRBV12-4 has barely been studied. The model's best guess: A variable immunoglobulin-like binding module from a human T-cell receptor beta chain that forms a high-specificity recognition surface for peptide–MHC ligands at the cell surface. By pairing with the alpha chain, it captures extracellular peptide–MHC and nucleates receptor–CD3 assemblies that initiate intracellular signaling cascades controlling lymphocyte activation and broader immune responses.","uniprot_summary":"Variable region of the beta chain of T-cell receptor (TCR) which recognizes peptide antigens presented by major histocompatibility complexes (MHC) and triggers T-cell responses.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006955","label":"immune response"}],"cellular_component":[{"id":"GO:0005886","label":"plasma membrane"}]},"interpro":[{"id":"IPR013783","name":"Immunoglobulin-like fold","type":"homologous_superfamily","start":19,"end":115},{"id":"IPR036179","name":"Immunoglobulin-like domain superfamily","type":"homologous_superfamily","start":23,"end":114},{"id":"IPR007110","name":"Immunoglobulin-like domain","type":"domain","start":21,"end":115},{"id":"IPR013106","name":"Immunoglobulin V-set domain","type":"domain","start":26,"end":113},{"id":"IPR050413","name":"T cell receptor beta variable","type":"family","start":3,"end":114}],"reasoning":"I begin with the InterPro architecture. The polypeptide core from residues 21–115 is defined by IPR007110 (Immunoglobulin-like domain), and this Ig scaffold is reinforced by two superfamily signatures—IPR013783 (Immunoglobulin-like fold, residues 19–115) and IPR036179 (Immunoglobulin-like domain superfamily, residues 23–114)—which together establish a beta-sandwich fold optimized for high-affinity, shape-complementary binding. Within this Ig framework sits IPR013106 (Immunoglobulin V-set domain, residues 26–113), a variable-type Ig module whose hypervariable loops create a concave binding surface. The family-level assignment IPR050413 (T cell receptor beta variable, residues 3–114) specifies that this variable domain belongs to the beta chain of a T-cell receptor complex. The ordered layout—an N-terminal TCR-beta-variable family signature leading into a V-set Ig domain embedded in canonical Ig-like superfamily scaffolds—causally dictates a ligand-recognition module that forms selective heterotypic interfaces rather than catalysis.\n\nThis Ig V-set architecture enforces molecular function as protein binding (GO:0005515). The V-set loops generate the paratope that engages peptide-loaded major histocompatibility complexes; the beta chain’s variable domain pairs with an alpha chain to form the composite binding site. The absence of catalytic motifs and the dominance of Ig-like binding topologies indicate that binding and signal initiation—not enzymatic chemistry—are the core activities.\n\nFrom this binding function, the biological process follows: recognition of peptide–MHC by the TCR initiates intracellular signaling cascades that orchestrate lymphocyte activation, gene expression, and effector programming. This places the protein squarely within the immune response (GO:0006955). The beta variable domain’s specificity channeling determines which peptide–MHC ligands trigger signaling, thereby gating downstream pathways that define T-cell activation thresholds and tolerance boundaries.\n\nCellular localization is dictated by the role of this variable domain as part of a cell-surface receptor. Ig-like TCR domains are displayed at the plasma membrane (GO:0005886), where they survey extracellular peptide–MHC ligands. Although the variable domain itself is soluble by fold, in vivo it is anchored via the rest of the receptor complex to the membrane, positioning the binding surface extracellularly.\n\nMechanistically, the beta variable domain forms a high-specificity binding interface that, when paired with the alpha chain, captures peptide–MHC and nucleates a signaling-competent complex. This binding event induces conformational and spatial rearrangements that propagate through the associated CD3 complex, culminating in Lck/ZAP-70 kinase recruitment and downstream signaling. I therefore hypothesize that this beta variable domain cooperatively interacts with the TCR alpha chain, the CD3 complex (CD3D, CD3E, CD3G, CD247), and signaling adaptors (LCK, ZAP70), while functionally coupling to peptide–MHC ligands presented by antigen-presenting cells. These assemblies at the plasma membrane translate extracellular recognition into intracellular immune signaling.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A0A0B4J2E0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A0A0B4J2E0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A0A0B4J2E0/entry","atlas":"/p/A0A0B4J2E0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}