{"uniprot":"A0A0U1RRK4","gene":"LBHD2","name":"LBH domain-containing protein 2","organism":"Homo sapiens (Human)","status":"dark","length":108,"sequence":"MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWPLESAQRGPSQSRAAAAPSPSLPGEPGKAADNAGSECACSEDPAAPARG","function_summary":"A small human adaptor that uses an LBH interaction module to assemble transcriptional co-regulatory complexes. By shuttling between cytosol and nucleus—and concentrating within nucleolar territories—it enhances RNA polymerase II–dependent gene expression programs that underpin development and cell-fate decisions. Its mechanism relies on multivalent protein binding that couples membrane-proximal signaling to nuclear activation of target genes.","plain_language":"LBHD2 has barely been studied. The model's best guess: A small human adaptor that uses an LBH interaction module to assemble transcriptional co-regulatory complexes. By shuttling between cytosol and nucleus—and concentrating within nucleolar territories—it enhances RNA polymerase II–dependent gene expression programs that underpin development and cell-fate decisions.","uniprot_summary":"May be involved in developmental processes and regulation of cell fate.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0045944","label":"positive regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005886","label":"plasma membrane"},{"id":"GO:0005730","label":"nucleolus"}]},"interpro":[{"id":"IPR038990","name":"LBH domain","type":"domain","start":37,"end":63},{"id":"IPR042945","name":"LBH domain containing protein","type":"family","start":1,"end":106}],"reasoning":"I begin with the InterPro architecture. The polypeptide is short and almost entirely encompassed by IPR042945 (LBH domain containing protein family, residues 1–106), with a discrete internal IPR038990 LBH domain (residues 37–63). This compact, single-module layout lacks enzymatic motifs and instead defines a small, low-complexity adaptor typical of LBH-domain proteins. The LBH core provides a structured interaction hub embedded within otherwise flexible regions, a configuration that causes multivalent protein association rather than catalysis. This architecture directly supports a molecular function centered on GO:0005515 protein binding.\n\nFrom this binding-centric scaffold, I infer transcriptional co-regulatory activity. LBH-domain adaptors frequently assemble transcriptional complexes that potentiate RNA polymerase II output. The presence of a single interaction-rich domain and absence of DNA-binding signatures argue that the protein modulates transcription indirectly—by recruiting or stabilizing transcription factors and coactivators—thereby driving GO:0045944 positive regulation of transcription by RNA polymerase II. Such a mechanism readily explains roles in developmental gene programs and cell-fate transitions.\n\nCellular localization follows from this regulatory logic and the sequence-derived constraints. The LBH module’s soluble nature and lack of transmembrane segments place the protein in non-membranous compartments. Its transcriptional co-regulatory role situates it in the nucleus, with accumulation in subnuclear territories such as the GO:0005730 nucleolus where ribosome biogenesis and transcriptional hubs interface. Dynamic shuttling and assembly/disassembly of complexes rationalize presence in the GO:0005829 cytosol. Transient association with signaling assemblies that feed into transcription explains detection at the GO:0005886 plasma membrane, where pathway inputs are integrated before nuclear translocation.\n\nMechanistically, I propose that the LBH domain nucleates transient assemblies that couple membrane-proximal signaling to nuclear transcriptional programs. At the plasma membrane, adaptor-mediated sensing of extracellular cues triggers cytosolic signaling cascades; the LBH scaffold then traffics to the nucleus and nucleolus, where it stabilizes transcriptional coactivator complexes to enhance RNA polymerase II-driven expression of developmental targets. Likely partners include chromatin-modifying coactivators and Mediator subunits that together amplify transcriptional output. This model coherently links the LBH architecture to protein binding (GO:0005515), to positive regulation of transcription by RNA polymerase II (GO:0045944), and to a soluble but signal-responsive distribution across cytosol, plasma membrane-associated assemblies, and nuclear subcompartments.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A0A0U1RRK4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A0A0U1RRK4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A0A0U1RRK4/entry","atlas":"/p/A0A0U1RRK4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}