{"uniprot":"A0A0U1RRL7","gene":"MMP24OS","name":"Protein MMP24OS","organism":"Homo sapiens (Human)","status":"dark","length":71,"sequence":"MGAQLSGGRGAPEPAQTQPQPQPQPAAPEGPEQPRHPPQPQPQPQPQPQPEPSPWGPLDDVRFLIACTSWY","function_summary":"A membrane-associated human adaptor that uses multivalent protein binding to stabilize client proteins and assemble transport and signaling modules at the Golgi. By scaffolding chaperones and trafficking factors, it enhances the stability of cytosolic proteins, promotes delivery of precursors toward the mitochondrial pathway, and boosts transcriptional programs by supporting the assembly and availability of transcriptional regulators. Its Golgi-centered positioning enables coordinated control of protein stabilization, mitochondrial targeting, and transcriptional activation.","plain_language":"MMP24OS has barely been studied. The model's best guess: A membrane-associated human adaptor that uses multivalent protein binding to stabilize client proteins and assemble transport and signaling modules at the Golgi. By scaffolding chaperones and trafficking factors, it enhances the stability of cytosolic proteins, promotes delivery of precursors toward the mitochondrial pathway, and boosts transcriptional programs by supporting the assembly and availability of transcriptional regulators.","uniprot_summary":"May be involved in transcription regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0050821","label":"protein stabilization"},{"id":"GO:1903955","label":"positive regulation of protein targeting to mitochondrion"},{"id":"GO:0045893","label":"positive regulation of DNA-templated transcription"}],"cellular_component":[{"id":"GO:0005794","label":"Golgi apparatus"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated feature: GO:0005515 protein binding as a core molecular function. The absence of catalytic InterPro domains and the presence of a broad binding label indicate a non-enzymatic scaffold/adaptor role. Coupled with a membrane-associated annotation, this architecture favors a peripheral or monotopic membrane binder that organizes other proteins rather than catalyzing reactions.\n\nFrom this binding-centric core, I infer molecular function first. A scaffold/adaptor anchored to membranes typically mediates selective protein–protein interactions that stabilize client proteins and assemble transport or signaling modules. This directly supports GO:0005515 protein binding as the operative molecular function.\n\nThis binding role causally explains several biological processes. Stabilization of client proteins follows naturally from a membrane-tethered scaffold that shields hydrophobic surfaces and coordinates chaperone access, aligning with GO:0050821 protein stabilization. The same adaptor logic extends to GO:1903955 positive regulation of protein targeting to mitochondrion: a membrane-localized binder can enhance mitochondrial targeting by transiently engaging precursor proteins and components of cytosolic import pathways, biasing their delivery toward mitochondrial receptors. Its influence on transcription arises through assembly and trafficking of transcriptional regulators; by stabilizing and positioning transcription factors and co-regulators, the adaptor promotes GO:0045893 positive regulation of DNA-templated transcription.\n\nCellular placement follows from the same chain. A membrane-anchored binder that organizes secretory and targeting pathways is expected at the Golgi interface. The Golgi apparatus is a central hub for cargo sorting and for preparing factors that subsequently act in the nucleus and at mitochondria. Thus, the architecture and functional logic converge on GO:0005794 Golgi apparatus as the cellular component, with membrane association enabling the necessary spatial coupling.\n\nMechanistically, I hypothesize that the protein operates as a Golgi-tethered adaptor that nucleates transient complexes. At the Golgi, it likely binds and stabilizes client proteins involved in vesicle trafficking and precursor handling. By recruiting chaperones and coat/adaptor modules, it enhances the stability and availability of transcriptional regulators and mitochondrial-destined precursors. This model predicts interactions with Golgi matrix and coat proteins (e.g., GM130/GOLGA2, golgins, COPI/COPII), cytosolic chaperones (HSP70/HSP90) that buffer client stability, and mitochondrial targeting machinery (cytosolic Hsp70 systems and TOM complex components). Such assemblies causally produce the observed outcomes: protein stabilization, enhanced mitochondrial targeting, and elevated transcriptional output.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A0A0U1RRL7.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A0A0U1RRL7"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A0A0U1RRL7/entry","atlas":"/p/A0A0U1RRL7"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}