{"uniprot":"A0A1B0GUS0","gene":"C19orf85","name":"Uncharacterized protein C19orf85","organism":"Homo sapiens (Human)","status":"dark","length":222,"sequence":"MHPGVPEGPGVSEPGPRELCAFVSGAAAHMLRALQPRRTRPPKRRPNHRRFLHNQICRQFTKIEAATQRLALSILSQEAPPQRPSLQKPPPPPPSPFLGVACAVAPTEAPHASASLSLAALDTSTLDLFDNIALTPECASMPWDPSSGSDAPLPAPGLSHRDLGQLDLRQVPHFCGPLPLPQHALGEEADLVAPDWGWVDCWEVPRAWDSQGIPEGWGTSSP","function_summary":"A human cytoplasmic adaptor that concentrates at the spindle and uses multivalent protein binding to assemble signaling and transcriptional complexes. By scaffolding kinases and coactivators in interphase and relocating to mitotic structures, it promotes signal flow and enhances RNA polymerase II–dependent transcription, coupling cell-division cues to gene-expression programs through a non-enzymatic assembly mechanism.","plain_language":"C19orf85 has barely been studied. The model's best guess: A human cytoplasmic adaptor that concentrates at the spindle and uses multivalent protein binding to assemble signaling and transcriptional complexes. By scaffolding kinases and coactivators in interphase and relocating to mitotic structures, it promotes signal flow and enhances RNA polymerase II–dependent transcription, coupling cell-division cues to gene-expression programs through a non-enzymatic assembly mechanism.","uniprot_summary":"May be involved in signal transduction and transcription regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007165","label":"signal transduction"},{"id":"GO:0045944","label":"positive regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005737","label":"cytoplasm"},{"id":"GO:0005819","label":"spindle"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The presence of only a generic protein-binding signature and no catalytic or transmembrane domains indicates a soluble adaptor/scaffold rather than an enzyme or transporter. Such architectures typically mediate multivalent interactions that assemble signaling and cytoskeletal complexes.\n\nFrom this scaffold-like core, the most direct molecular function is protein binding (GO:0005515). A binding-centric architecture causes regulatory outcomes by positioning partners into higher-order assemblies. This scaffolding role naturally drives signal transduction (GO:0007165), because adaptor platforms nucleate and route information flow between receptors and downstream effectors. The same assembly logic explains positive regulation of transcription by RNA polymerase II (GO:0045944): by recruiting transcriptional regulators and coactivators to promoter-proximal hubs, the scaffold enhances transcriptional output without intrinsic DNA-binding or enzymatic activity.\n\nCellular context refines the mechanism. Localization to the cytoplasm (GO:0005737) and spindle (GO:0005819) places the adaptor at mitotic machinery. During cell division, spindle-associated scaffolds coordinate checkpoint signaling and re-establish transcriptional programs as cells exit mitosis. The cytoplasm-to-spindle trafficking suggests that the adaptor senses or relays mitotic cues and then promotes transcriptional recovery via RNA polymerase II.\n\nMechanistically, I hypothesize that the protein forms a bipartite platform: in interphase, it binds signaling kinases and transcriptional coactivators to potentiate Pol II-driven transcription; in mitosis, it concentrates at the spindle where it binds microtubule-associated proteins and checkpoint factors. This dual residency allows it to couple spindle status to gene-expression pathways. Likely partners include spindle organizers (e.g., TPX2, NuMA1), microtubule regulators (EB1/MAPRE1), and transcriptional assemblies (Mediator and TFIID components), consistent with a cytoplasmic scaffold that transiently enriches at the spindle to tune signaling and transcriptional outputs.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A0A1B0GUS0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A0A1B0GUS0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A0A1B0GUS0/entry","atlas":"/p/A0A1B0GUS0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}