{"uniprot":"A0A1B0GVG6","gene":"TEX54","name":"Testis-expressed protein 54","organism":"Homo sapiens (Human)","status":"dark","length":124,"sequence":"MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG","function_summary":"A human cytosolic adaptor that organizes protein assemblies to coordinate innate immune signaling with cytoskeletal remodeling. By using multivalent binding rather than catalysis, it assembles complexes that reshape actin and transiently associate with membrane systems to trigger defense pathways and a hypersensitive-like programmed cell death module. Its soluble nature places it predominantly in the cytosol with dynamic engagement at the plasma membrane and other membrane-bounded compartments, where it orchestrates immune effector functions.","plain_language":"TEX54 has barely been studied. The model's best guess: A human cytosolic adaptor that organizes protein assemblies to coordinate innate immune signaling with cytoskeletal remodeling. By using multivalent binding rather than catalysis, it assembles complexes that reshape actin and transiently associate with membrane systems to trigger defense pathways and a hypersensitive-like programmed cell death module.","uniprot_summary":"May be involved in the innate immune response.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0045087","label":"innate immune response"},{"id":"GO:0009626","label":"plant-type hypersensitive response"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005886","label":"plasma membrane"},{"id":"GO:0043231","label":"intracellular membrane-bounded organelle"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The presence of only a generic protein-binding signature and no catalytic or transmembrane domains indicates a soluble adaptor/scaffold rather than an enzyme or transporter. Such architectures typically mediate multivalent interactions that assemble signaling complexes and remodel the cytoskeleton.\n\nFrom this binding-centric core, the molecular function resolves as GO:0005515 protein binding. A non-enzymatic scaffold that concentrates partners can directly cause changes in actin dynamics and membrane-proximal signaling. This binding capacity explains how the protein can couple to both cytoskeletal and membrane-associated assemblies.\n\nThis binding-driven mechanism naturally extends to biological processes. First, assembling and tuning innate immune signaling complexes aligns with GO:0045087 innate immune response. By organizing adaptors and effectors at membrane-proximal sites, the scaffold can potentiate early defense pathways. Second, its role in a hypersensitive-like cell death program is captured by GO:0009626 plant-type hypersensitive response; in humans, this manifests as programmed cell death or arrest that restricts pathogen spread and shapes immune responses. The scaffold’s ability to coordinate cytoskeletal remodeling and membrane trafficking provides the causal bridge between immune signaling and localized cell death.\n\nCellular localization follows from the same logic. A soluble adaptor without transmembrane segments resides primarily in the cytoplasm, consistent with GO:0005829 cytosol. Its transient association with membrane-proximal complexes supports GO:0005886 plasma membrane and the broader GO:0043231 intracellular membrane-bounded organelle, reflecting shuttling between cytosol and organelle-associated signaling hubs. This distribution enables rapid assembly and disassembly of complexes at membrane interfaces.\n\nMechanistically, I hypothesize that the protein forms a hub that binds actin regulators and membrane-associated adaptors to choreograph immune signaling and cytoskeletal remodeling. Likely partners include small GTPases and actin-nucleation machinery that drive cell-shape changes and endocytic/exocytic routes central to defense. By stabilizing these assemblies at the cytosol–membrane interface, the scaffold can trigger innate immune pathways and a hypersensitive-like death program that confines intracellular pathogens.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A0A1B0GVG6.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A0A1B0GVG6"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A0A1B0GVG6/entry","atlas":"/p/A0A1B0GVG6"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}