{"uniprot":"A0A1B0GWK0","gene":"PVALEF","name":"Parvalbumin-like EF-hand-containing protein","organism":"Homo sapiens (Human)","status":"dark","length":134,"sequence":"MEEDFSSQMKKMALAMGTSLSDKDIELLPTDMRHHGSFNYLKFFKHIRKLHASGQLDDAIHTAFQSLDKDKSGFIEWNEIKYILSIIPSSGPTTPLTDEEAEAMIQAADTHGDGRINYEEFSELIKKEKIPKKK","function_summary":"A soluble human calcium-binding protein that uses a paired EF-hand fold to sense and buffer cytosolic calcium, thereby tuning calcium-dependent protein interactions that stabilize signaling and cytoskeletal assemblies. By damping local calcium transients and transiently engaging cytosolic partners, it supports fast visual pathway signaling and actin-rich structures in the cytoplasm, where it modulates assembly and timing of protein complexes rather than catalyzing reactions.","plain_language":"PVALEF has barely been studied. The model's best guess: A soluble human calcium-binding protein that uses a paired EF-hand fold to sense and buffer cytosolic calcium, thereby tuning calcium-dependent protein interactions that stabilize signaling and cytoskeletal assemblies. By damping local calcium transients and transiently engaging cytosolic partners, it supports fast visual pathway signaling and actin-rich structures in the cytoplasm, where it modulates assembly and timing of protein complexes rather than catalyzing reactions.","uniprot_summary":"Inhibits enzymes, exerts a calcium-dependent protein binding activity.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007601","label":"visual perception"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0015629","label":"actin cytoskeleton"}]},"interpro":[{"id":"IPR011992","name":"EF-hand domain pair","type":"homologous_superfamily","start":8,"end":126},{"id":"IPR002048","name":"EF-hand domain","type":"domain","start":55,"end":131},{"id":"IPR008080","name":"Parvalbumin","type":"family","start":9,"end":127},{"id":"IPR018247","name":"EF-Hand 1, calcium-binding site","type":"binding_site","start":68,"end":80}],"reasoning":"I begin with the InterPro architecture. The core scaffold is IPR011992 (EF-hand domain pair, residues 8–126), indicating a tandem EF-hand arrangement that coordinates calcium and drives conformational switching. Within this scaffold sits IPR002048 (EF-hand domain, residues 55–131), marking a canonical helix–loop–helix calcium-binding module. The sequence is further classified as IPR008080 (Parvalbumin family, residues 9–127), a soluble EF-hand calcium-binding protein class known for high-affinity Ca2+ buffering and cytosolic signaling roles. Critically, IPR018247 (EF-Hand 1, calcium-binding site, residues 68–80) pinpoints a functional Ca2+-coordinating loop, establishing that at least one EF-hand is competent for binding. The ordered layout—an EF-hand pair with a validated binding site—causes calcium-dependent conformational changes that regulate interactions with other proteins rather than catalysis.\n\nThis EF-hand architecture dictates molecular function. EF-hands bind Ca2+ and thereby modulate affinity for partner proteins; the parvalbumin family typically acts as fast cytosolic Ca2+ buffers and transient adaptors. Such buffering and Ca2+-dependent docking support GO:0005515 protein binding as the operative molecular function, with calcium binding serving as the mechanistic driver that tunes binding surfaces.\n\nFrom function to process, calcium-buffering adaptors in neurons and muscle directly shape stimulus–response coupling. In the retina and associated neural circuits, rapid Ca2+ transients govern photoreceptor and interneuron signaling; a soluble EF-hand buffer that fine-tunes cytosolic Ca2+ dynamics naturally contributes to GO:0007601 visual perception by stabilizing signaling thresholds and timing in visual pathways.\n\nCellular context follows from solubility and binding behavior. The absence of transmembrane segments and the EF-hand soluble fold place the protein in the cytosol, aligning with GO:0005829 cytosol. EF-hand buffers that regulate actin-associated assemblies often localize near cytoskeletal structures; parvalbumin-family proteins frequently associate with actin-rich zones and spectrin/ankyrin networks. This supports presence at the GO:0015629 actin cytoskeleton, where Ca2+-regulated binding can modulate filament dynamics and membrane–cytoskeleton coupling.\n\nMechanistically, the EF-hand pair binds Ca2+ via the annotated site (68–80), shifting the protein between low- and high-affinity states for cytosolic partners. This switching enables transient sequestration and handoff of Ca2+ near actin assemblies and membrane-proximal complexes, damping local Ca2+ spikes and coordinating actin remodeling. I hypothesize interactions with actin and actin-regulatory proteins (e.g., cofilin, profilin), with spectrin/ankyrin scaffolds that organize the neuronal cytoskeleton, and with Ca2+-handling machinery such as calmodulin-dependent enzymes and membrane Ca2+ pumps. In retinal circuits, association with photoreceptor or bipolar-cell cytoskeletal complexes would couple Ca2+ buffering to visual signal fidelity.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A0A1B0GWK0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A0A1B0GWK0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A0A1B0GWK0/entry","atlas":"/p/A0A1B0GWK0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}