{"uniprot":"A0A286YF60","gene":"SCYGR3","name":"Small cysteine and glycine repeat-containing protein 3","organism":"Homo sapiens (Human)","status":"dark","length":100,"sequence":"MGCCGCGSCGGCGGGCGGCGGGCGGGCGGGCGGVCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCRSCGCGCRKGCCQQKCCCQKQCCC","function_summary":"A small, soluble neuronal scaffold that uses a cysteine–glycine repeat core to assemble cytosolic protein complexes controlling calcium-responsive pathways tied to higher-order brain functions. By organizing transient adaptor and cytoskeletal assemblies rather than catalyzing reactions, it modulates signaling and structural processes that support cognition and cellular responses to calcium, operating predominantly in the cytosol.","plain_language":"SCYGR3 has barely been studied. The model's best guess: A small, soluble neuronal scaffold that uses a cysteine–glycine repeat core to assemble cytosolic protein complexes controlling calcium-responsive pathways tied to higher-order brain functions. By organizing transient adaptor and cytoskeletal assemblies rather than catalyzing reactions, it modulates signaling and structural processes that support cognition and cellular responses to calcium, operating predominantly in the cytosol.","uniprot_summary":"May be involved in higher mental functions.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0050890","label":"cognition"},{"id":"GO:0071277","label":"cellular response to calcium ion"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"}]},"interpro":[{"id":"IPR063164","name":"Small cysteine and glycine repeat-containing protein","type":"family","start":37,"end":100}],"reasoning":"I begin with the InterPro architecture: a single annotated region, IPR063164 (Small cysteine and glycine repeat-containing protein family) spanning residues 37–100. This family defines compact, low-complexity scaffolds enriched in cysteine and glycine motifs that often form repeat-driven interaction modules rather than catalytic cores. The central placement of this repeat block and the absence of recognizable enzymatic domains argue that the polypeptide functions primarily through multivalent binding. Such repeat-rich scaffolds typically mediate transient assemblies and signal-modulated interactions, which causally supports a molecular role centered on GO:0005515 protein binding.\n\nFrom this binding-centric architecture, I infer function in neuronal signaling and plasticity. The small cysteine/glycine-repeat scaffold can nucleate complexes that tune cytoskeletal dynamics and membrane-proximal signaling. This binding capacity provides a mechanistic route to cognition-related pathways, aligning with GO:0050890 cognition: by organizing adaptor networks that influence synaptic efficacy and neuronal circuit performance. The same scaffold can couple to calcium-responsive pathways. Although it lacks catalytic Ca2+-handling motifs, its repeat module can recruit Ca2+-regulated partners and thereby drive GO:0071277 cellular response to calcium ion—its architecture enables assembly and modulation of Ca2+-responsive effectors rather than direct ion transport.\n\nCellular placement follows from the soluble, non-membranous architecture and the need to sample diverse cytoplasmic signaling hubs. The absence of transmembrane segments or secretion signals, together with the scaffold’s soluble nature, points to a cytosolic residency consistent with GO:0005829 cytosol. A cytosolic scaffold can efficiently interface with actin regulators, endomembrane-associated adaptors, and Ca2+-responsive enzymes.\n\nMechanistically, I hypothesize that the cysteine/glycine repeat core forms a flexible platform that binds multiple partners to coordinate calcium-tuned neuronal pathways. By clustering calcium-sensitive adaptors and cytoskeletal regulators in the cytosol, it can bias synaptic structure and signaling cascades that underlie higher-order brain functions. Likely interaction partners include Ca2+-responsive signaling proteins (e.g., calmodulin and CaMK pathways), small GTPase modules that govern actin remodeling, and membrane-proximal adaptors that couple receptor activity to downstream effectors. Together, these assemblies provide a tunable cytosolic hub that links calcium signaling to cognitive processes.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A0A286YF60.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A0A286YF60"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A0A286YF60/entry","atlas":"/p/A0A286YF60"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}