{"uniprot":"A1L162","gene":"ERICH2","name":"Glutamate-rich protein 2","organism":"Homo sapiens (Human)","status":"dark","length":156,"sequence":"METVNEPETGEVSKDAVIVKQEKNNEYCLQDIDDKLSESAEDDGEDDTNDEDDDEDSNPKKNTQAPLELMAEFLRAEMAREYQLAKKLCQMILIYEPENPEAKEFFTLIEEMLLMEKTQNHEQDGENSDEDSSGESKGESDEELSDESSDEGEDGS","function_summary":"A soluble, glutamate-rich human scaffold that operates through multivalent protein binding to coordinate neurodevelopmental programs. It assembles and remodels cytosolic complexes that guide neuronal architecture and signaling, then shuttles to the nucleoplasm where it engages regulatory assemblies that tune gene expression. By coupling cytoskeletal organization with nuclear control modules, it supports pathways central to brain development and differentiation.","plain_language":"ERICH2 has barely been studied. The model's best guess: A soluble, glutamate-rich human scaffold that operates through multivalent protein binding to coordinate neurodevelopmental programs. It assembles and remodels cytosolic complexes that guide neuronal architecture and signaling, then shuttles to the nucleoplasm where it engages regulatory assemblies that tune gene expression.","uniprot_summary":"May be involved in developmental processes.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007420","label":"brain development"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR026703","name":"Glutamate-rich protein 2","type":"family","start":2,"end":156}],"reasoning":"I begin with the InterPro architecture: IPR026703 (Glutamate-rich protein 2 family) spans residues 2–156, essentially covering the entire polypeptide. A family-level signature that blankets the sequence indicates a conserved, non-enzymatic scaffold specialized by its glutamate-rich composition. Acidic, glutamate-rich architectures typically create extended, low-complexity interaction surfaces that favor multivalent binding to other proteins rather than catalysis. This compositionally biased scaffold explains a primary molecular function of protein binding (GO:0005515), where avidity and phase behavior of acidic segments drive assembly and remodeling of macromolecular complexes.\n\nFrom this binding-centric core, I infer the biological role by considering where such scaffolds act and to what end. Glutamate-rich, non-enzymatic scaffolds often tune developmental pathways by organizing signaling and cytoskeletal assemblies. The explicit developmental context is brain development (GO:0007420). A glutamate-rich binder that shuttles between cytosolic and nuclear compartments can coordinate transcriptional programs and cytoskeletal dynamics that together sculpt neuronal proliferation, migration, and differentiation. Thus, the architecture causes a binding-driven regulatory mechanism that feeds directly into neurodevelopmental pathways.\n\nCellular localization follows from the same logic. The absence of transmembrane domains and the presence of a soluble, low-complexity scaffold point to a cytosolic pool, aligning with the cytosol (GO:0005829). The additional nucleoplasm localization (GO:0005654) indicates regulated nuclear entry, where the same binding surfaces can engage chromatin-associated or transcriptional regulators. This cytosol-to-nucleoplasm shuttling provides a mechanistic bridge: cytosolic complex assembly upstream, nuclear complex handoff downstream.\n\nMechanistically, I hypothesize that the protein operates as a bifunctional organizer. In the cytosol, its glutamate-rich scaffold nucleates assemblies with cytoskeletal and signaling partners, stabilizing transient complexes that guide neurite outgrowth and cell motility. Upon nuclear entry, it likely binds transcriptional co-regulators and chromatin-associated factors to align gene expression with cytoskeletal states during brain development. This shuttling scaffold model explains the observed protein-binding function, the developmental process linkage, and the dual cytosolic and nucleoplasmic residence.\n\nPotential interaction partners follow from this mechanism. In the cytosol, associations with tubulin and actin assemblies, spectrin/ankyrin networks, and adaptor/scaffold proteins would be favored by multivalent acidic surfaces. In the nucleus, transient contacts with transcriptional coactivators, chromatin remodelers, and RNA-processing factors would be expected as the nucleoplasmic pool coordinates developmental gene programs. Together, these interactions position the protein as a soluble organizer that couples cytoskeletal architecture to nuclear regulatory circuits during neurodevelopment.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A1L162.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A1L162"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A1L162/entry","atlas":"/p/A1L162"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}