{"uniprot":"A6NCJ1","gene":"C19orf71","name":"Uncharacterized protein C19orf71","organism":"Homo sapiens (Human)","status":"dark","length":209,"sequence":"MQTLRQEAARPCIPSGTLEASFPAPLYSDDYLSLEGSRWPPAIRQATRWKYTPMGRDAAGQLWYTGLTNSDAWEAWYNLPRAPASPFREAYNRWHSCYQHRECSMPSAYTQHLRETAWHDPIVPAQYQAPSTRWGSALWKDRPIRGKEYVLNRNRYGVEPLWRASDYVPSLSAPQRPPGTTQNYREWVLEPYCPSTCQRSPPSLTPTPR","function_summary":"A soluble assembly scaffold that supports mitochondrial function by organizing and stabilizing the biogenesis of respiratory complex I. It concentrates assembly intermediates within the mitochondrial interior and nucleoids to promote complex I maturation and membrane association, thereby sustaining overall organelle organization and bioenergetic capacity. A minor nucleoplasmic pool likely participates in nucleo-mitochondrial coordination that tunes assembly pathways and import of mitochondrial biogenesis factors.","plain_language":"C19orf71 has barely been studied. The model's best guess: A soluble assembly scaffold that supports mitochondrial function by organizing and stabilizing the biogenesis of respiratory complex I. It concentrates assembly intermediates within the mitochondrial interior and nucleoids to promote complex I maturation and membrane association, thereby sustaining overall organelle organization and bioenergetic capacity.","uniprot_summary":"Plays a role in mitochondrial function.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007005","label":"mitochondrion organization"},{"id":"GO:0032981","label":"mitochondrial respiratory chain complex I assembly"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"},{"id":"GO:0005739","label":"mitochondrion"}]},"interpro":[{"id":"IPR029203","name":"Tektin bundle-interacting protein 1","type":"family","start":1,"end":207}],"reasoning":"I begin with the InterPro architecture: IPR029203 (Tektin bundle-interacting protein 1 family) spans residues 1–207 and covers the entire polypeptide. A single, full-length family signature without catalytic subdomains indicates a soluble, non-enzymatic scaffold specialized for binding and organizing partner proteins. The “tektin bundle-interacting” lineage implies affinity for filament-associated assemblies and predicts a primary molecular role as a multivalent binder rather than an enzyme. This architecture causally supports GO:0005515 protein binding as the molecular function.\n\nA binding-centric scaffold of this family is poised to chaperone assembly pathways. The explicit linkage to mitochondrial bioenergetics emerges from its role in complex I biogenesis: by stabilizing and coordinating assembly intermediates, it drives GO:0032981 mitochondrial respiratory chain complex I assembly. The same binding capacity can be repurposed to shape mitochondrial ultrastructure—tethering or stabilizing nucleoids and inner-membrane-associated assemblies—thereby influencing GO:0007005 mitochondrion organization. The causal chain is: a full-length binding scaffold (IPR029203) organizes multiprotein complexes; this organization promotes complex I assembly; complex I maturation and membrane association in turn maintain mitochondrial architecture and function.\n\nCellular localization follows from this assembly logic and the observed compartmental dynamics. The absence of transmembrane features and the presence of a soluble scaffold architecture argue for matrix-facing and nucleoid-associated pools rather than membrane insertion. This supports a primary mitochondrial residence consistent with GO:0005739 mitochondrion and with experimental mitochondrial localization. A nucleoplasmic pool (GO:0005654 nucleoplasm) is also observed; such nuclear presence can be explained by transient nucleo-mitochondrial communication or assembly-factor trafficking that tunes mitochondrial biogenesis from a nuclear hub.\n\nMechanistically, I hypothesize that the protein forms a matrix/nucleoid-localized assembly platform that binds nascent complex I modules and their assembly factors. By concentrating assembly intermediates and recruiting accessory factors, it accelerates electron-transport chain maturation and stabilizes inner-membrane association of complex I. Likely interaction partners include core and accessory complex I assembly factors (e.g., NDUFAF family proteins), mitochondrial nucleoid organizers, and matrix-facing chaperones. The nucleoplasmic fraction may interface with nuclear complexes that regulate expression or import of mitochondrial assembly machinery, thereby coupling nuclear programs to mitochondrial biogenesis.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A6NCJ1.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A6NCJ1"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A6NCJ1/entry","atlas":"/p/A6NCJ1"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}