{"uniprot":"A6NHG4","gene":"DDTL","name":"D-dopachrome decarboxylase-like protein","organism":"Homo sapiens (Human)","status":"dark","length":134,"sequence":"MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRFPTVLSTSPAAHGGPRCPGEIIEGKKSCLNEEALFIYFI","function_summary":"A soluble immune-modulatory protein that assembles into a trimeric scaffold to regulate inflammatory signaling and cell motility. It operates primarily through multivalent protein binding, enhancing ERK pathway output and elevating cytokine production, including tumor necrosis factor. By tuning chemotactic machinery it can restrain macrophage migration. The protein functions mainly in the cytoplasm and is also packaged into extracellular vesicles, enabling cytosolic signaling with potential paracrine dissemination via exosomes.","plain_language":"DDTL has barely been studied. The model's best guess: A soluble immune-modulatory protein that assembles into a trimeric scaffold to regulate inflammatory signaling and cell motility. It operates primarily through multivalent protein binding, enhancing ERK pathway output and elevating cytokine production, including tumor necrosis factor.","uniprot_summary":"Probable tautomerase with low DHTPDase activity (By similarity). Has been implicated in a number of diverse functions including immunomodulation, apoptosis, and myoblast differentiation (By similarity).","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0050729","label":"positive regulation of inflammatory response"},{"id":"GO:0010760","label":"negative regulation of macrophage chemotaxis"},{"id":"GO:0032760","label":"positive regulation of tumor necrosis factor production"},{"id":"GO:0070374","label":"positive regulation of ERK1 and ERK2 cascade"}],"cellular_component":[{"id":"GO:0005737","label":"cytoplasm"},{"id":"GO:0070062","label":"extracellular exosome"}]},"interpro":[{"id":"IPR014347","name":"Tautomerase/MIF superfamily","type":"homologous_superfamily","start":2,"end":110},{"id":"IPR001398","name":"Macrophage migration inhibitory factor","type":"family","start":1,"end":102},{"id":"IPR019829","name":"Macrophage migration inhibitory factor, conserved site","type":"conserved_site","start":55,"end":69}],"reasoning":"I begin with the InterPro architecture. The polypeptide is dominated by IPR014347 (Tautomerase/MIF superfamily, residues 2–110), a homologous superfamily that encodes a compact β–α fold used broadly for tautomerase chemistry and as a versatile protein–protein interaction scaffold. Nested within this scaffold is IPR001398 (Macrophage migration inhibitory factor family, residues 1–102), which specifies the lineage-specific features that bias the fold toward immune-modulatory signaling rather than classical enzymatic catalysis. Centrally, IPR019829 (Macrophage migration inhibitory factor, conserved site, residues 55–69) marks a conserved patch that typically coordinates ligand or partner binding and stabilizes oligomeric assemblies. The ordered layout—an N-terminal MIF-family core embedded in a tautomerase-like superfamily, capped by a conserved interaction site—creates a soluble, trimer-prone platform optimized for multivalent protein binding rather than substrate turnover. This architecture causally supports GO:0005515 protein binding as the primary molecular function.\n\nFrom this binding-centric core, the mechanistic consequences unfold in immune signaling. The MIF-family scaffold is known to nucleate assemblies that potentiate MAPK pathways; here, the conserved site (55–69) and the trimeric tautomerase-like surface provide docking surfaces that amplify upstream cues feeding into ERK modules, explaining positive regulation of ERK1 and ERK2 cascade (GO:0070374). By stabilizing signaling complexes that drive cytokine expression, the same scaffold elevates inflammatory outputs, accounting for positive regulation of inflammatory response (GO:0050729) and positive regulation of tumor necrosis factor production (GO:0032760). At the cellular behavior level, the fold’s inhibitory imprint—encoded by the MIF family—modulates chemotactic circuits in macrophages. Through context-dependent assembly with chemotaxis regulators and cytoskeletal adaptors, it can dampen macrophage motility, aligning with negative regulation of macrophage chemotaxis (GO:0010760).\n\nThe absence of transmembrane segments and the soluble nature of the tautomerase/MIF fold place the protein in the cytoplasm, consistent with a cytosolic signaling hub that assembles and releases complexes as needed. In parallel, immune-modulatory proteins of this class are frequently trafficked in extracellular vesicles; the conserved interaction surface and oligomerization propensity facilitate loading into vesicles, supporting localization to extracellular exosome (GO:0070062). Together, these features argue for a cytoplasmic origin with exosomal export.\n\nMechanistically, I hypothesize that the trimeric MIF-family core forms a high-avidity platform that recruits small GTPases and MAPK adaptors to potentiate ERK signaling while simultaneously tuning chemotaxis machinery. Likely partners include cytosolic GTPases and their adaptors that govern inflammatory signaling and cell movement. Exosomal association suggests transient interactions with vesicle biogenesis factors, enabling extracellular dissemination of the protein to modulate neighboring cells.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A6NHG4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A6NHG4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A6NHG4/entry","atlas":"/p/A6NHG4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}