{"uniprot":"A6NKF2","gene":"ARID3C","name":"AT-rich interactive domain-containing protein 3C","organism":"Homo sapiens (Human)","status":"dark","length":412,"sequence":"MEALQKQQAARLAQGVGPLAPACPLLPPQPPLPDHRTLQAPEGALGNVGAEEEEDAEEDEEKREEAGAEEEAAEESRPGAQGPSSPSSQPPGLHPHEWTYEEQFKQLYELDADPKRKEFLDDLFSFMQKRGTPVNRVPIMAKQVLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSAAFTLRTQYMKYLYPYECETRALSSPGELQAAIDSNRREGRRQAYTATPLFGLAGPPPRGAQDPALGPGPAPPATQSSPGPAQGSTSGLPAHACAQLSPSPIKKEESGIPNPCLALPVGLALGPTREKLAPEEPPEKRAVLMGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEINGVVYTGVLFARRQPVPASQGPTNPAPPPSTGPPSSILP","function_summary":"A human transcriptional regulator that uses an AT-rich DNA-binding core to anchor on regulatory elements and a C-terminal assembly module to recruit cofactors, thereby enhancing RNA polymerase II–dependent gene activation. It operates predominantly in the nucleoplasm while maintaining a cytoplasmic pool that supports shuttling and complex assembly. By coupling DNA tethering with multivalent protein interactions, it promotes transcriptional programs associated with neuronal and myogenic differentiation.","plain_language":"ARID3C has barely been studied. The model's best guess: A human transcriptional regulator that uses an AT-rich DNA-binding core to anchor on regulatory elements and a C-terminal assembly module to recruit cofactors, thereby enhancing RNA polymerase II–dependent gene activation. It operates predominantly in the nucleoplasm while maintaining a cytoplasmic pool that supports shuttling and complex assembly.","uniprot_summary":"Transcriptional regulator that may be involved in the regulation of neuronal and myogenic transcription.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0045944","label":"positive regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005737","label":"cytoplasm"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR036431","name":"ARID DNA-binding domain superfamily","type":"homologous_superfamily","start":97,"end":221},{"id":"IPR001606","name":"ARID DNA-binding domain","type":"domain","start":113,"end":206},{"id":"IPR023334","name":"REKLES domain","type":"domain","start":304,"end":389},{"id":"IPR045147","name":"AT-rich interactive domain-containing protein 3","type":"family","start":50,"end":256}],"reasoning":"I begin with the InterPro architecture. The central portion of the protein is defined by IPR036431 (ARID DNA-binding domain superfamily, residues 97–221), within which sits a more specific DNA-recognition module, IPR001606 (ARID DNA-binding domain, residues 113–206). This tandem of a superfamily envelope and its core ARID domain establishes a sequence-specific DNA-binding module that typically targets AT-rich regulatory elements and anchors transcriptional regulators to chromatin. The N-to-mid region is further classified by IPR045147 (AT-rich interactive domain-containing protein 3 family, residues 50–256), which ties this ARID-centered core to the ARID3 clade known for transcriptional control. In the C-terminal half, IPR023334 (REKLES domain, residues 304–389) appears; REKLES modules in ARID proteins mediate higher-order assembly and nucleic-acid-associated scaffolding, often coupling DNA binding to multivalent protein–protein interactions and subcellular trafficking. The ordered layout—ARID3-family framework leading into a high-affinity ARID DNA-binding core and followed by a REKLES assembly platform—creates a bipartite system: DNA anchoring that specifies regulatory targeting, and a REKLES-driven interaction hub that recruits cofactors and modulates localization.\n\nThis architecture causes a molecular function centered on multivalent macromolecular association. The ARID core confers DNA tethering, while the REKLES domain expands interaction valency; together they enforce GO:0005515 protein binding as a primary functional readout. The ARID3 family context predicts assembly of transcriptional complexes rather than enzymatic catalysis.\n\nFrom this molecular function, the biological process follows. ARID-directed chromatin engagement typically elevates transcriptional output by stabilizing activators and coactivators at promoters and enhancers. The REKLES-mediated scaffolding further biases toward assembly of positive regulatory modules, aligning with GO:0045944 positive regulation of transcription by RNA polymerase II. Such a mechanism readily explains roles in lineage programs: anchoring and recruiting coactivators at neuronal or myogenic regulatory loci can drive cell-type–specific transcriptional activation.\n\nCellular localization is dictated by the same modules. The ARID core and REKLES platform jointly support nucleic-acid-associated assemblies in the nucleus, specifically the GO:0005654 nucleoplasm where transcriptional complexes concentrate. Dynamic shuttling and assembly/disassembly cycles, typical for REKLES-containing factors, rationalize a cytoplasmic pool (GO:0005737 cytoplasm) that likely serves as a reservoir and transit compartment before nuclear import or after export.\n\nMechanistically, I hypothesize that the ARID domain anchors the protein to AT-rich regulatory DNA, while the REKLES domain nucleates complexes with transcriptional coactivators and chromatin remodelers to potentiate RNA polymerase II initiation and elongation. Likely partners include histone acetyltransferases and Mediator subunits that amplify transcriptional output. In neuronal and myogenic contexts, cooperative binding with lineage-defining transcription factors would focus activation at cell-type–specific enhancers. Transient cytoplasmic interactions with importins and 14-3-3–like adaptors could regulate nuclear entry and complex assembly cycles.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A6NKF2.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A6NKF2"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A6NKF2/entry","atlas":"/p/A6NKF2"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}