{"uniprot":"A6NKQ9","gene":"CGB1","name":"Choriogonadotropin subunit beta variant 1","organism":"Homo sapiens (Human)","status":"dark","length":187,"sequence":"MSTFPVLAEDIPLRERHVKGRVDPHFRAPKMEMFQRLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGP","function_summary":"A secreted, disulfide-rich glycoprotein hormone subunit that assembles into a heterodimeric ligand and signals through cell-surface receptors to coordinate reproductive and broader endocrine pathways. Its cystine-knot fold and gonadotropin-specific motifs stabilize extracellular signaling, driving intercellular communication and downstream pathways that support gamete production and modulate cell-fate decisions. The protein operates outside the cell, where its beta subunit confers receptor specificity and tunes signal transduction cascades.","plain_language":"CGB1 has barely been studied. The model's best guess: A secreted, disulfide-rich glycoprotein hormone subunit that assembles into a heterodimeric ligand and signals through cell-surface receptors to coordinate reproductive and broader endocrine pathways. Its cystine-knot fold and gonadotropin-specific motifs stabilize extracellular signaling, driving intercellular communication and downstream pathways that support gamete production and modulate cell-fate decisions.","uniprot_summary":"Glycoprotein hormone beta subunit.","go_terms":{"molecular_function":[{"id":"GO:0005179","label":"hormone activity"}],"biological_process":[{"id":"GO:0007267","label":"cell-cell signaling"},{"id":"GO:0007165","label":"signal transduction"},{"id":"GO:0007292","label":"female gamete generation"},{"id":"GO:0006915","label":"apoptotic process"}],"cellular_component":[{"id":"GO:0005576","label":"extracellular region"}]},"interpro":[{"id":"IPR029034","name":"Cystine-knot cytokine","type":"homologous_superfamily","start":51,"end":161},{"id":"IPR006208","name":"Glycoprotein hormone subunit beta","type":"domain","start":57,"end":160},{"id":"IPR001545","name":"Gonadotropin, beta subunit","type":"family","start":31,"end":163},{"id":"IPR018245","name":"Gonadotropin, beta subunit, conserved site","type":"conserved_site","start":84,"end":90},{"id":"IPR018245","name":"Gonadotropin, beta subunit, conserved site","type":"conserved_site","start":133,"end":160}],"reasoning":"I begin with the InterPro architecture. The core of the protein is defined by IPR029034 (Cystine-knot cytokine homologous_superfamily, residues 51–161), a hallmark of secreted, disulfide-rich signaling modules that fold into a cystine-knot and often function as heterodimeric hormones. Nested within this scaffold is IPR006208 (Glycoprotein hormone subunit beta domain, residues 57–160), which specifies the beta subunit of the glycoprotein hormone family that determines receptor specificity. The broader lineage is reinforced by IPR001545 (Gonadotropin, beta subunit family, residues 31–163), indicating membership in the vertebrate gonadotropin beta subunits that pair with the common alpha subunit to form active heterodimers. Two conserved motifs, IPR018245 (Gonadotropin, beta subunit, conserved site, residues 84–90) and IPR018245 (Gonadotropin, beta subunit, conserved site, residues 133–160), mark critical cystine-knot and receptor-determinant regions that stabilize the fold and encode binding determinants. The ordered layout—an N-terminal region feeding into a cystine-knot core with gonadotropin-beta-defining motifs—causes secretion-competent folding, high stability in extracellular fluids, and precise receptor engagement characteristic of hormone-active glycoprotein heterodimers.\n\nThis architecture dictates the molecular function. The cystine-knot hormone framework and gonadotropin beta determinants together produce a secreted ligand that signals through specific cell-surface receptors; this is the essence of GO:0005179 hormone activity. The beta subunit confers receptor specificity and thereby tunes downstream signaling pathways.\n\nFrom this hormone activity, the biological processes follow. As a secreted ligand, the protein mediates GO:0007267 cell-cell signaling by binding receptors on target cells and propagating extracellular cues. The ensuing receptor-driven cascades instantiate GO:0007165 signal transduction, where the beta subunit’s receptor selectivity determines pathway choice. In reproductive contexts, this signaling promotes GO:0007292 female gamete generation by supporting follicular and oocyte-supportive pathways. Additionally, trophic and survival signaling downstream of receptor pathways can modulate cell fate; thus, the same signaling axis can engage GO:0006915 apoptotic process, either by suppressing apoptosis in target tissues or, context-dependently, by triggering apoptosis as part of follicular remodeling.\n\nThe cellular component is dictated by secretion. The cystine-knot fold and glycoprotein hormone beta domain are archetypal for soluble extracellular hormones that are released from the cell. This supports localization to GO:0005576 extracellular region and aligns with a secreted subcellular fate.\n\nMechanistically, the beta subunit’s conserved sites and cystine-knot stabilize a heterodimer with the common alpha subunit, forming a high-affinity ligand that binds cognate receptors at the cell surface. This binding initiates intracellular signaling that governs reproductive tissue physiology and broader systemic pathways. I hypothesize that the protein assembles with the alpha subunit to form the active hormone, then engages cell-surface receptors on gonadal and endocrine tissues. Likely partners include the alpha subunit of the heterodimer and receptor complexes that respond to glycoprotein hormone signals; downstream, canonical signal transduction modules are recruited to execute reproductive and apoptotic programs in a context-dependent manner.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A6NKQ9.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A6NKQ9"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A6NKQ9/entry","atlas":"/p/A6NKQ9"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}