{"uniprot":"A8MTQ0","gene":"NOTO","name":"Homeobox protein notochord","organism":"Homo sapiens (Human)","status":"dark","length":251,"sequence":"MPSPRPRGSPPPAPSGSRVRPPRSGRSPAPRSPTGPNTPRAPGRFESPFSVEAILARPDPCAPAASQPSGSACVHPAFWTAASLCATGGLPWACPTSWLPAYLSVGFYPVPGPRVAPVCGLLGFGVTGLELAHCSGLWAFPDWAPTEDLQDTERQQKRVRTMFNLEQLEELEKVFAKQHNLVGKKRAQLAARLKLTENQVRVWFQNRRVKYQKQQKLRAAVTSAEAASLDEPSSSSIASIQSDDAESGVDG","function_summary":"A nuclear transcriptional regulator that uses a homeodomain to bind specific DNA motifs and assemble repressive regulatory complexes during development. It concentrates in the nucleoplasm where it modulates RNA polymerase II–dependent transcription, likely by recruiting corepressors and chromatin-modifying enzymes to enforce silenced chromatin at target enhancers and promoters. Transient cytosolic pools reflect nucleo-cytoplasmic shuttling, but its functional core operates in the nucleus to shape developmental gene-expression programs.","plain_language":"NOTO has barely been studied. The model's best guess: A nuclear transcriptional regulator that uses a homeodomain to bind specific DNA motifs and assemble repressive regulatory complexes during development. It concentrates in the nucleoplasm where it modulates RNA polymerase II–dependent transcription, likely by recruiting corepressors and chromatin-modifying enzymes to enforce silenced chromatin at target enhancers and promoters.","uniprot_summary":"Transcription factor that may be involved in developmental processes.","go_terms":{"molecular_function":[{"id":"GO:1990837","label":"sequence-specific double-stranded DNA binding"},{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0000122","label":"negative regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"},{"id":"GO:0005829","label":"cytosol"}]},"interpro":[{"id":"IPR009057","name":"Homeodomain-like superfamily","type":"homologous_superfamily","start":140,"end":216},{"id":"IPR001356","name":"Homeodomain","type":"domain","start":154,"end":218},{"id":"IPR050877","name":"EMX/VAX/Noto Homeobox Transcription Factors","type":"family","start":3,"end":247}],"reasoning":"I begin with the InterPro architecture. The polypeptide carries IPR050877 (EMX/VAX/Noto Homeobox Transcription Factors family) spanning residues 3–247, which frames the entire protein as a member of a developmental homeobox transcription factor family. Nested within this family scaffold is IPR009057 (Homeodomain-like superfamily, residues 140–216), and centrally embedded is IPR001356 (Homeodomain, residues 154–218). This ordered layout—an N-terminal family-defining region leading into a canonical homeodomain—establishes a sequence-specific DNA-binding module that recognizes short cis-regulatory motifs and recruits transcriptional machinery. The homeodomain’s helix-turn-helix fold and basic residues typically mediate high-affinity binding to double-stranded DNA, while flanking regions in the EMX/VAX family often provide repression or activation interfaces.\n\nFrom this architecture, the molecular function resolves into two complementary activities. The homeodomain (IPR001356) and its superfamily context (IPR009057) cause sequence-specific double-stranded DNA binding, aligning with GO:1990837 sequence-specific double-stranded DNA binding. The broader EMX/VAX/Noto family envelope (IPR050877) and the extended low-complexity surfaces that accompany homeodomains create multivalent protein–protein interfaces, supporting GO:0005515 protein binding. Together, these features define a transcriptional regulator that both binds DNA and assembles regulatory complexes.\n\nThe biological process follows from the regulatory logic of homeobox factors. The EMX/VAX/Noto family frequently imposes transcriptional repression by recruiting corepressors and chromatin modifiers; thus the architecture predicts negative control of RNA polymerase II-driven transcription, consistent with GO:0000122 negative regulation of transcription by RNA polymerase II. In a developmental context, such repression sculpts gene-expression boundaries that guide regionalization and differentiation.\n\nCellular localization is dictated by the need to access chromatin. The presence of a canonical homeodomain and transcriptional regulatory role places the protein in the nucleus, specifically within the nucleoplasm where transcriptional complexes assemble (GO:0005654 nucleoplasm). Dynamic nucleo-cytoplasmic exchange and cytosolic pools of unbound transcription factors explain detection in the cytosol (GO:0005829 cytosol), but the functional center of gravity remains nuclear.\n\nMechanistically, the protein likely binds specific enhancers or silencers via its homeodomain and enforces repression by recruiting corepressor assemblies. The EMX/VAX/Noto family signature suggests interfaces for Groucho/TLE and HDAC-containing complexes, which would deacetylate nearby histones and stabilize a closed chromatin state. I therefore hypothesize that it forms complexes with TLE/Groucho adaptors and class I/II HDACs, and cooperates with other homeobox and HMG-box factors to fine-tune developmental transcriptional programs. This cooperative assembly explains both its DNA-binding specificity and its repressive transcriptional output in the nucleus and nucleoplasm.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A8MTQ0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A8MTQ0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A8MTQ0/entry","atlas":"/p/A8MTQ0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}