{"uniprot":"A8MUP6","gene":"GSG1L2","name":"Germ cell-specific gene 1-like protein 2","organism":"Homo sapiens (Human)","status":"dark","length":293,"sequence":"MDRAKQQQALLLLPVCLALTFSLTAVVSSHWCEGTRRVVKPLCQDQPGGQHCIHFKRDNSSNGRMDNNSQAVLYIWELGDDKFIQRGFHVGLWQSCEESLNGEDEKCRSFRSVVPAEEQGVLWLSIGGEVLDIVLILTSAILLGSRVSCRSPGFHWLRVDALVAIFMVLAGLLGMVAHMMYTTIFQITVNLGPEDWKPQTWDYGWSYCLAWGSFALCLAVSVSAMSRFTAARLEFTEKQQAQNGSRHSQHSFLEPEASESIWKTGAAPCPAEQAFRNVSGHLPPGAPGKVSIC","function_summary":"A membrane-proximal scaffold in human cells that assembles multiprotein complexes at the endoplasmic reticulum and in the cytoplasm to tune postsynaptic signaling. By coupling a cytosolic scaffold module to an ER-associated framework, it organizes factors that control AMPA receptor biogenesis and tuning, thereby modulating synaptic transmission. Its mechanism centers on multivalent protein binding that positions and regulates receptor assembly and trafficking pathways at intracellular membranes.","plain_language":"GSG1L2 has barely been studied. The model's best guess: A membrane-proximal scaffold in human cells that assembles multiprotein complexes at the endoplasmic reticulum and in the cytoplasm to tune postsynaptic signaling. By coupling a cytosolic scaffold module to an ER-associated framework, it organizes factors that control AMPA receptor biogenesis and tuning, thereby modulating synaptic transmission.","uniprot_summary":"May be involved in synaptic transmission.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0050804","label":"modulation of chemical synaptic transmission"},{"id":"GO:2000311","label":"regulation of AMPA receptor activity"}],"cellular_component":[{"id":"GO:0005789","label":"endoplasmic reticulum membrane"}]},"interpro":[{"id":"IPR012478","name":"GSG1-like","type":"family","start":5,"end":119},{"id":"IPR050579","name":"Peripheral myelin protein 22/Epithelial membrane protein-like","type":"family","start":8,"end":243}],"reasoning":"I begin with the InterPro architecture. The N-terminal half carries IPR012478 (GSG1-like family, residues 5–119), a hallmark of the GSG1 clade that forms cytosolic scaffolds associated with neuronal RNA/protein assemblies. This module is embedded within and extended by IPR050579 (Peripheral myelin protein 22/Epithelial membrane protein-like family, residues 8–243), a membrane-protein superfamily whose members typically form multi-pass or tightly associated membrane-proximal scaffolds. The ordered layout—an extended GSG1-like core nested within a membrane-associated family—creates a bipartite architecture: a cytosolic-facing scaffold that couples to intracellular membranes and membrane-embedded clients. Such an arrangement predisposes the protein to multivalent protein binding rather than catalysis, directly supporting GO:0005515 protein binding as the molecular function.\n\nFrom this scaffolded, membrane-proximal foundation, I infer roles in synaptic signaling control. The GSG1-like core provides a platform that organizes cytosolic factors near endoplasmic reticulum (ER) and endomembrane surfaces, while the PMP22/EMP-like framework anchors or senses membrane assemblies. This architecture causes regulation of postsynaptic receptor pathways by positioning and tuning membrane-associated complexes. That causal chain aligns with modulation of synaptic throughput, captured by GO:0050804 modulation of chemical synaptic transmission. More specifically, the scaffold’s proximity to membrane trafficking and assembly hubs enables it to influence AMPA receptor biogenesis, gating, and tuning—consistent with GO:2000311 regulation of AMPA receptor activity.\n\nCellular placement follows from the same architecture. The PMP22/EMP-like signature and the experimentally supported membrane association point to an intracellular membrane environment. The explicit localization to the ER is mechanistically coherent: ER membranes serve as assembly and quality-control stations for neurotransmitter receptors and their auxiliary factors. Thus, the most precise compartmentalization is GO:0005789 endoplasmic reticulum membrane, with a soluble cytoplasmic pool that feeds assembly pathways and cytosolic scaffolds.\n\nMechanistically, I hypothesize that the protein operates as an ER-anchored adaptor that binds cytosolic partners via its GSG1-like region and couples them to ER-resident receptor assembly machinery via its membrane-associated framework. This coupling would tune AMPA receptor activity by controlling receptor folding, ER export, and postsynaptic complex maturation. Likely interaction partners include AMPA receptor subunits and auxiliary proteins, ER export machinery, and cytosolic synaptic scaffolds. Together, these interactions would allow the protein to modulate chemical synaptic transmission by regulating AMPA receptor function from an ER-centered assembly hub.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A8MUP6.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A8MUP6"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A8MUP6/entry","atlas":"/p/A8MUP6"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}