{"uniprot":"A8MYZ5","gene":"IQCF6","name":"IQ domain-containing protein F6","organism":"Homo sapiens (Human)","status":"dark","length":107,"sequence":"MVRRTLLQAALRAWVIQCWWRSMQAKMLEQRRRLALRLYTCQEWAVVKVQAQVRMWQARRRFLQARQAACIIQSHWRWHASQTRGLIRGHYEVRASRLELDIEILMT","function_summary":"A small human adaptor protein that centers on tandem IQ motifs to bind calcium-sensor partners and organize multiprotein assemblies during spermiogenesis. By using a calmodulin-recognition platform, it stabilizes and times the assembly of the sperm’s axoneme and coordinates vesicle–cytoskeleton interfaces in the sperm head. Its soluble, peripherally associated nature and enrichment at acrosomal compartments position it to couple calcium-responsive binding to the construction and maturation of germ-cell structures.","plain_language":"IQCF6 has barely been studied. The model's best guess: A small human adaptor protein that centers on tandem IQ motifs to bind calcium-sensor partners and organize multiprotein assemblies during spermiogenesis. By using a calmodulin-recognition platform, it stabilizes and times the assembly of the sperm’s axoneme and coordinates vesicle–cytoskeleton interfaces in the sperm head.","uniprot_summary":"May be involved in spermiogenesis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007288","label":"sperm axoneme assembly"}],"cellular_component":[{"id":"GO:0001669","label":"acrosomal vesicle"}]},"interpro":[{"id":"IPR039887","name":"IQ domain-containing protein F","type":"family","start":1,"end":106},{"id":"IPR000048","name":"IQ motif, EF-hand binding site","type":"binding_site","start":44,"end":62},{"id":"IPR000048","name":"IQ motif, EF-hand binding site","type":"binding_site","start":66,"end":77}],"reasoning":"I begin with the InterPro architecture. The polypeptide is encompassed by IPR039887 (IQ domain-containing protein F family, residues 1–106), indicating a compact, single-chain scaffold specialized for IQ-motif–mediated interactions. Within this family envelope lie two EF-hand–binding IQ modules: IPR000048 (IQ motif, EF-hand binding site) at residues 44–62 and a second IQ motif at residues 66–77. The tandem IQ arrangement creates a bipartite calmodulin-recognition platform. IQ motifs bind EF-hand calcium sensors—most notably calmodulin—and frequently act as conformational adaptors that recruit and regulate partner proteins rather than catalyzing reactions. The absence of enzymatic domains and the presence of duplicated IQ motifs together argue that this protein functions primarily through multivalent protein binding, consistent with GO:0005515 protein binding as its molecular function.\n\nFrom this binding-centric core, I infer the biological role. IQ-motif adaptors in germ cells commonly coordinate axonemal assembly and flagellar function by docking calmodulin and other calcium-responsive partners to structural modules. Such scaffolding is causally suited to organize tubulin-based axonemes and accessory structures during spermiogenesis. This logic supports involvement in GO:0007288 sperm axoneme assembly: the tandem IQ architecture provides a tunable interface that stabilizes and times assembly steps governed by calcium signaling.\n\nCellular placement follows from both architecture and known germline pathways. The acrosomal vesicle is a secretory organelle derived from the Golgi that seeds the acrosome and interfaces with the sperm head’s cytoskeleton and flagellar base. An IQ-driven adaptor that orchestrates axoneme assembly naturally traffics through or resides at the acrosomal compartment, aligning with GO:0001669 acrosomal vesicle. The family-level envelope (IPR039887) and the IQ tandem together favor a soluble, peripherally associated protein that concentrates at vesicle–cytoskeleton junctions in the sperm head and transiently at the flagellar base.\n\nMechanistically, the tandem IQ motifs create a calmodulin-docking hub that modulates partner affinity in a calcium-dependent manner. This causes the protein to act as a molecular adaptor that nucleates or stabilizes assemblies required for axoneme formation and maturation of spermatids. I hypothesize that it binds calmodulin and calmodulin-like EF-hand proteins to tune local calcium signaling, while engaging acrosomal and axonemal scaffolds. Likely partners include calmodulin itself and sperm-specific structural/regulatory complexes that operate at the acrosomal vesicle and the assembling flagellum.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-A8MYZ5.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/A8MYZ5"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/A8MYZ5/entry","atlas":"/p/A8MYZ5"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}