{"uniprot":"B1AK76","gene":"SNURFL","name":"Putative SNURF-like protein","organism":"Homo sapiens (Human)","status":"dark","length":121,"sequence":"MEQARDHLHLRWTTEQHMPEVEVQVKYRTAALSNQECQLYLRHSQQQQVLVVDFQAKLRQVFITETPRCGKKPYWNNEEAESKQNPGSIYCLLLLIRGGMSDSLIKREISNFEIVSKNKKN","function_summary":"A small nuclear adaptor that concentrates in nuclear bodies and uses multivalent protein binding to assemble repressive hubs that dampen RNA polymerase II–driven transcription. By organizing intranuclear assemblies that coordinate transcriptional repression with RNA-processing environments, it fine-tunes gene-expression programs within the nucleus through scaffold-like interactions rather than catalysis.","plain_language":"SNURFL has barely been studied. The model's best guess: A small nuclear adaptor that concentrates in nuclear bodies and uses multivalent protein binding to assemble repressive hubs that dampen RNA polymerase II–driven transcription. By organizing intranuclear assemblies that coordinate transcriptional repression with RNA-processing environments, it fine-tunes gene-expression programs within the nucleus through scaffold-like interactions rather than catalysis.","uniprot_summary":"May be involved in transcriptional regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0000122","label":"negative regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0016604","label":"nuclear body"}]},"interpro":[{"id":"IPR009847","name":"SNURF family","type":"family","start":2,"end":68}],"reasoning":"I begin with the domain architecture. The sequence carries a single annotated module, IPR009847 (SNURF family, residues 2–68), which spans essentially the entire polypeptide. A compact, single-domain architecture of this kind typically encodes a regulatory adaptor rather than a catalytic enzyme. SNURF-family proteins are small, often intrinsically disordered binders that concentrate in nuclear substructures; this architecture predisposes the protein to multivalent interactions with other macromolecules. Such a scaffold-like core causally supports GO:0005515 protein binding as the primary molecular function.\n\nFrom this binding-centric foundation, I infer regulatory rather than enzymatic roles. The SNURF-family fold is frequently coupled to transcriptional control modules, and a small nuclear adaptor of this type is well-suited to repress RNA polymerase II output by recruiting or stabilizing repressive assemblies. This mechanistic logic aligns with GO:0000122 negative regulation of transcription by RNA polymerase II: the protein’s binding surface can nucleate or stabilize repressor complexes that attenuate Pol II-driven gene expression.\n\nCellular localization follows from both the domain family and functional role. The SNURF architecture is known to concentrate in membraneless nuclear assemblies, and repression of Pol II commonly occurs within nuclear bodies that coordinate transcription and RNA processing. This points to GO:0016604 nuclear body as the cellular component. The stated nuclear localization is consistent with this inference and further supports a soluble, intranuclear residence rather than membrane association.\n\nIntegrating these lines of evidence yields a coherent mechanism: a small SNURF-family adaptor that binds other proteins and concentrates in nuclear bodies to dampen Pol II transcription. By assembling or stabilizing repressive hubs—potentially through contacts with transcriptional repressors, chromatin-modifying enzymes, or RNA-processing factors—the protein tunes gene-expression thresholds in the nucleus.\n\nThis model suggests likely interaction partners. To execute transcriptional repression within nuclear bodies, the protein would plausibly engage Pol II-associated repressors and chromatin regulators. Candidates include RNA polymerase II and its repressive cofactors (e.g., NCOR/SMRT complexes), histone deacetylases (HDAC1/2) that enforce chromatin compaction, and nuclear body organizers such as PML and SP100 that scaffold intranuclear assemblies. Additional transient contacts with spliceosomal or RNA-binding factors could couple transcriptional repression to RNA maturation within these compartments.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-B1AK76.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/B1AK76"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/B1AK76/entry","atlas":"/p/B1AK76"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}