{"uniprot":"B7Z368","gene":"C10orf142","name":"Uncharacterized protein C10orf142","organism":"Homo sapiens (Human)","status":"dark","length":130,"sequence":"MRMYSSDAHERPPSPSLGTTPPHPLPPTGSPRPRQDSAAGNSEEREPRGLRRASGVGSSCKRPTVCMGRQQGLPFCTVCGYRCSSPERTRGRCAVGKVRVAGGGGAPGGGAGMRCCGCRERNINKELELF","function_summary":"A small human membrane-associated protein that likely acts as a membrane-tethered adaptor, using protein–protein interactions to assemble and modulate signaling complexes that govern programmed cell death. By anchoring at the cell surface and organizing effectors and adaptors, it helps tune the initiation and execution of apoptosis, consistent with a role in cell-fate control at the plasma membrane.","plain_language":"C10orf142 has barely been studied. The model's best guess: A small human membrane-associated protein that likely acts as a membrane-tethered adaptor, using protein–protein interactions to assemble and modulate signaling complexes that govern programmed cell death. By anchoring at the cell surface and organizing effectors and adaptors, it helps tune the initiation and execution of apoptosis, consistent with a role in cell-fate control at the plasma membrane.","uniprot_summary":"May be involved in apoptosis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006915","label":"apoptotic process"}],"cellular_component":[{"id":"GO:0005886","label":"plasma membrane"}]},"interpro":[{"id":"IPR041059","name":"Protein of of unknown function DUF5558","type":"family","start":1,"end":126}],"reasoning":"I begin with the domain architecture. The sequence is entirely encompassed by IPR041059 (Protein of unknown function DUF5558 family) spanning residues 1–126. A single, compact DUF that covers the full length of the polypeptide and is annotated as a membrane-associated family implies a small, likely single-pass membrane protein with minimal soluble regions. Such architectures typically lack catalytic cores and instead function through surface-mediated interactions—consistent with a role driven by protein binding rather than enzymatic chemistry.\n\nA full-length DUF5558 module that defines membrane association causally supports a molecular function centered on multivalent protein binding (GO:0005515). The absence of recognizable catalytic motifs and the compact size argue that this protein acts as a membrane-tethered adaptor or scaffold that organizes other factors through transient binding. This binding-centric mechanism aligns with a role in assembling or modulating signaling complexes.\n\nFrom this binding foundation, I infer the biological process. Membrane-tethered adaptors frequently gate cell-fate decisions by nucleating receptor-proximal complexes that trigger or buffer programmed cell death. The explicit linkage to apoptosis is mechanistically coherent: a membrane-localized scaffold can bias downstream pathways by recruiting pro- or anti-apoptotic effectors and tuning signal flux. This places the protein squarely within the apoptotic process (GO:0006915), where membrane-proximal assembly and trafficking decisions determine commitment to cell death.\n\nThe cellular component follows directly from the architecture and function. A small, single-pass membrane protein with a DUF that enforces membrane association is expected to reside at the plasma membrane, where receptor signaling and apoptotic initiation are orchestrated. This supports localization to the plasma membrane (GO:0005886), where the protein can couple extracellular cues to intracellular apoptotic machinery.\n\nMechanistically, I hypothesize that the DUF5558 fold stabilizes a membrane-anchored platform that binds other proteins to tune apoptotic thresholds. At the plasma membrane, it likely associates with receptor complexes and endocytic machinery to control the dwell time and internalization of death receptors or stress-sensing pathways. By concentrating adaptors and effectors, it can bias signaling toward or away from apoptosis. Likely partners include receptor-proximal adaptors and caspase-activating modules; endocytic coat components; and cytoskeletal linkers that transmit membrane-derived cues. Together, these interactions would allow a small membrane-tethered binder to exert outsized influence on apoptotic decision-making.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-B7Z368.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/B7Z368"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/B7Z368/entry","atlas":"/p/B7Z368"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}