{"uniprot":"C9JBD0","gene":"KRBOX1","name":"KRAB domain-containing protein 1","organism":"Homo sapiens (Human)","status":"dark","length":128,"sequence":"MMTAVSLTTRPQESVAFEDVAVYFTTKEWAIMVPAERALYRDVMLENYEAVAFVVPPTSKPALVSHLEQGKESCFTQPQGVLSRNDWRAGWIGYLELRRYTYLAKAVLRRIVSKIFRNRQCWEDRRKA","function_summary":"A nuclear transcriptional regulator that uses an N-terminal repression module to assemble co-repressor complexes and modulate chromatin, thereby tuning gene expression programs. It operates predominantly in the nucleoplasm, where it silences target loci through chromatin compaction while also enabling context-dependent activation of transcriptional pathways important for brain development. By scaffolding repressive and activating assemblies, it coordinates transcriptional outputs and dampens serine/threonine kinase–responsive pathways at the level of chromatin and transcriptional machinery.","plain_language":"KRBOX1 has barely been studied. The model's best guess: A nuclear transcriptional regulator that uses an N-terminal repression module to assemble co-repressor complexes and modulate chromatin, thereby tuning gene expression programs. It operates predominantly in the nucleoplasm, where it silences target loci through chromatin compaction while also enabling context-dependent activation of transcriptional pathways important for brain development.","uniprot_summary":"May be involved in transcriptional regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007420","label":"brain development"},{"id":"GO:0045892","label":"negative regulation of DNA-templated transcription"},{"id":"GO:0045944","label":"positive regulation of transcription by RNA polymerase II"},{"id":"GO:0071901","label":"negative regulation of protein serine/threonine kinase activity"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR036051","name":"Krueppel-associated box domain superfamily","type":"homologous_superfamily","start":9,"end":71},{"id":"IPR001909","name":"Krueppel-associated box","type":"domain","start":14,"end":86},{"id":"IPR050169","name":"Krueppel C2H2-type zinc-finger","type":"family","start":11,"end":79}],"reasoning":"I begin with the InterPro architecture. The N-terminal half contains IPR036051 (Krueppel-associated box domain superfamily, residues 9–71) and a more specific instance IPR001909 (Krueppel-associated box, residues 14–86). This tandem of a superfamily envelope and a core KRAB module establishes a repression engine that recruits co-repressor assemblies. Overlapping these, IPR050169 (Krueppel C2H2-type zinc-finger family, residues 11–79) indicates a classical C2H2 zinc-finger lineage. In canonical KRAB-ZNF proteins, the KRAB domain sits N-terminally and the C2H2 array mediates sequence-specific DNA recognition; here, the overlap and compact span suggest a tightly coupled KRAB–C2H2 module that prioritizes repression and chromatin engagement. The ordered layout—KRAB repression module followed by zinc-finger lineage—causes strong protein-binding capacity through co-repressor recruitment and multivalent chromatin contacts, aligning with GO:0005515 protein binding as the operative molecular function.\n\nFrom this molecular scaffold, I infer regulatory outcomes. The KRAB module nucleates transcriptional repression by assembling co-repressor complexes that deposit repressive chromatin marks and compact nucleosomes. This directly supports negative regulation of DNA-templated transcription (GO:0045892). Yet KRAB-driven assemblies can also transiently stimulate transcriptional competence by clearing inhibitory chromatin or by priming enhancers that subsequently elevate RNA polymerase II output; such context-dependent assembly is consistent with positive regulation of transcription by RNA polymerase II (GO:0045944). The developmental label brain development (GO:0007420) follows naturally: KRAB-ZNF regulators commonly sculpt neuronal gene-expression programs by toggling chromatin states at neurodevelopmental loci. The negative regulation of protein serine/threonine kinase activity (GO:0071901) fits a mechanism in which chromatin compaction and sequestration of signaling-responsive transcriptional hubs dampen kinase-driven pathways at the level of gene-expression targets.\n\nCellular placement follows from the domain logic and known behavior of KRAB assemblies. The absence of transmembrane features and the presence of chromatin-tethering modules point to a soluble nuclear regulator. The operational site of KRAB-mediated repression and chromatin remodeling is the nucleoplasm, matching GO:0005654 nucleoplasm and the broader nuclear localization.\n\nMechanistically, the KRAB domain recruits a co-repressor scaffold that seeds heterochromatinization and transcriptional silencing at selected loci. The C2H2 lineage contributes DNA-anchoring and complex stabilization, ensuring high-avidity protein binding and durable repression. In neural contexts, this architecture modulates gene networks that guide brain development, while transiently enabling polymerase II–dependent transcription at specific loci through chromatin remodeling cycles. I hypothesize that the protein forms assemblies with canonical KRAB partners to read and write chromatin states, thereby tuning kinase-responsive pathways and developmental transcriptional programs.\n\nTo ground this mechanistic model in likely partners, the KRAB module typically engages a corepressor scaffold that recruits histone-modifying and chromatin-compacting enzymes. I therefore anticipate interactions with a KRAB-recruited scaffold (e.g., TRIM28/KAP1), H3K9 methyltransferases (e.g., SETDB1), HP1 chromodomain proteins (e.g., CBX family), and NuRD/HDAC complexes. These assemblies would explain both repression and context-dependent activation, and they would localize and stabilize the regulator within the nucleoplasm where chromatin-based control of transcription and signaling is executed.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-C9JBD0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/C9JBD0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/C9JBD0/entry","atlas":"/p/C9JBD0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}