{"uniprot":"E9PB15","gene":"PTGES3L","name":"Putative protein PTGES3L","organism":"Homo sapiens (Human)","status":"dark","length":166,"sequence":"MFSLPLNCSPDHIRRGSCWGRPQDLKIAAPAWNSKCHPGAGAAMARQHARTLWYDRPRYVFMEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKPVWLSVDFDNWRDWEGDEEMELAHVEHYAELLKKVSTKRPPPAMDDLDDDSDSADDATSN","function_summary":"A soluble co-chaperone that uses a p23-like HSP20 scaffold to bind and stabilize client proteins within Hsp90/Hsp70 cycles. By tuning proteostasis in both cytoplasm and nucleoplasm, it supports neuronal differentiation and the organization of cellular projections, and it coordinates mitochondrial integrity. Its binding-driven mechanism modulates translation bidirectionally—dampening or enhancing protein synthesis—through assembly and regulation of client complexes that shape neuronal morphogenesis and organellar organization.","plain_language":"PTGES3L has barely been studied. The model's best guess: A soluble co-chaperone that uses a p23-like HSP20 scaffold to bind and stabilize client proteins within Hsp90/Hsp70 cycles. By tuning proteostasis in both cytoplasm and nucleoplasm, it supports neuronal differentiation and the organization of cellular projections, and it coordinates mitochondrial integrity.","uniprot_summary":"May have a role in neurite morphogenesis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0030182","label":"neuron differentiation"},{"id":"GO:0030030","label":"cell projection organization"},{"id":"GO:0017148","label":"negative regulation of translation"},{"id":"GO:0007005","label":"mitochondrion organization"},{"id":"GO:0045727","label":"positive regulation of translation"}],"cellular_component":[{"id":"GO:0005737","label":"cytoplasm"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR008978","name":"HSP20-like chaperone","type":"homologous_superfamily","start":46,"end":142},{"id":"IPR007052","name":"CS domain","type":"domain","start":46,"end":154},{"id":"IPR045250","name":"Co-chaperone protein p23-like","type":"family","start":44,"end":106}],"reasoning":"I begin with the InterPro architecture. The core of the protein is defined by IPR007052 (CS domain, residues 46–154), a hallmark module of p23/Sgt1-like co-chaperones that stabilizes Hsp90-centered folding cycles. This CS fold is embedded within IPR008978 (HSP20-like chaperone homologous superfamily, residues 46–142), indicating an α-crystallin-like chaperone scaffold that binds client proteins and chaperone machineries. The presence of IPR045250 (Co-chaperone protein p23-like family, residues 44–106) specifies the functional class as a p23-like co-chaperone that modulates Hsp90/Hsp70 cycles. The ordered layout—an HSP20-like chaperone core coincident with a CS domain and a p23-like signature—creates a non-enzymatic binding platform optimized for multivalent protein interactions rather than catalysis. This architecture causes broad, avid protein binding consistent with GO:0005515 protein binding as the molecular function.\n\nFrom this binding-centric scaffold, I infer the biological roles by considering how p23-like modules regulate client maturation. By stabilizing Hsp90/Hsp70 assemblies, such co-chaperones tune the assembly and activity of cytoskeletal and signaling complexes that drive neuronal morphogenesis. This mechanistic influence maps to GO:0030182 neuron differentiation and GO:0030030 cell projection organization, because folding control of cytoskeletal regulators and membrane–cytoskeleton adaptors is a prerequisite for neurite initiation and axon/dendrite elaboration. The same chaperone axis also governs mitochondrial proteostasis and the biogenesis of mitochondrial proteins; coupling Hsp90/p23-like pathways to mitochondrial client handling explains GO:0007005 mitochondrion organization.\n\nThe dual-direction control of translation emerges from how chaperone–client assemblies interface with ribosome-associated factors. By buffering the availability and conformation of translational regulators and ribosome-associated complexes, this scaffold can either suppress or enhance protein synthesis. This bidirectional tuning aligns with GO:0017148 negative regulation of translation and GO:0045727 positive regulation of translation, reflecting context-dependent outcomes during stress responses and developmental programs.\n\nCellular localization follows from the soluble, non-membranous architecture and the known operating compartments of Hsp90/p23-like systems. The absence of transmembrane segments and the chaperone superfamily identity support a soluble distribution in the cytoplasm and nucleus. Chaperone-guided assembly of transcriptional and RNA-processing complexes places the protein in the nucleoplasm, while cytoplasmic folding cycles and cytoskeletal organization situate it in the cytoplasm. Thus, the cellular component is consistent with GO:0005737 cytoplasm and GO:0005654 nucleoplasm.\n\nMechanistically, I hypothesize that the CS-domain p23-like core binds Hsp90 and Hsp70 to stabilize client maturation pathways that govern neuronal morphogenesis and mitochondrial integrity. By transiently associating with cytoskeletal clients and translation regulators, it modulates both cytoplasmic and nuclear proteostasis. Likely interaction partners include Hsp90 and Hsp70 chaperone systems and their client cohorts—cytoskeletal proteins and RNA/ribosome-associated factors—providing a tunable hub that coordinates neurite organization and mitochondrial organization through chaperone-mediated assembly and quality control.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-E9PB15.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/E9PB15"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/E9PB15/entry","atlas":"/p/E9PB15"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}