{"uniprot":"K7EJ46","gene":"SMIM22","name":"Small integral membrane protein 22","organism":"Homo sapiens (Human)","status":"dark","length":83,"sequence":"MAVSTEELEATVQEVLGRLKSHQFFQSTWDTVAFIVFLTFMGTVLLLLLLVVAHCCCCSSPGPRRESPRKERPKGVDNLALEP","function_summary":"A small multi-pass membrane modulator that assembles Golgi-centered protein complexes to coordinate lipid droplet biogenesis and cytoskeleton-coupled trafficking. By using membrane-embedded scaffolding and cytosolic loop interactions, it promotes budding and maturation of lipid droplets at Golgi-derived sites, tunes secretory pathway flux, and couples these events to actin remodeling that drives cell migration. This Golgi-anchored regulatory hub influences proliferation and cell-cycle progression and is distributed between the Golgi apparatus, cytoplasm, and contiguous endoplasmic reticulum–nuclear envelope membranes.","plain_language":"SMIM22 has barely been studied. The model's best guess: A small multi-pass membrane modulator that assembles Golgi-centered protein complexes to coordinate lipid droplet biogenesis and cytoskeleton-coupled trafficking. By using membrane-embedded scaffolding and cytosolic loop interactions, it promotes budding and maturation of lipid droplets at Golgi-derived sites, tunes secretory pathway flux, and couples these events to actin remodeling that drives cell migration.","uniprot_summary":"May be involved in cell proliferation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0051726","label":"regulation of cell cycle"},{"id":"GO:0042127","label":"regulation of cell population proliferation"},{"id":"GO:0030335","label":"positive regulation of cell migration"},{"id":"GO:0032956","label":"regulation of actin cytoskeleton organization"},{"id":"GO:0140042","label":"lipid droplet formation"}],"cellular_component":[{"id":"GO:0005794","label":"Golgi apparatus"}]},"interpro":[{"id":"IPR053081","name":"Small Integral Membrane Modulators","type":"family","start":5,"end":83},{"id":"IPR031671","name":"Small integral membrane protein 5/18/22","type":"family","start":6,"end":58}],"reasoning":"I begin with the InterPro architecture. The sequence carries IPR053081 (Small Integral Membrane Modulators family) spanning residues 5–83 and IPR031671 (Small integral membrane protein 5/18/22 family) spanning residues 6–58. These overlapping family signatures define a compact, multi-pass membrane module that lacks catalytic cores but is optimized for membrane-embedded regulation. The N-to-C arrangement—an extended small-integral-membrane scaffold (IPR053081) enveloping a tighter SMIM5/18/22 core (IPR031671)—creates a polytopic platform that binds other membrane and cytosolic partners rather than performing enzymatic chemistry. This architecture causally supports a molecular function centered on multivalent protein binding (GO:0005515), because short luminal/cytosolic loops and hydrophobic helices in small membrane modulators typically tune trafficking and cytoskeletal interfaces through protein–protein interactions.\n\nFrom this binding-centric membrane scaffold, I infer roles that require spatially organized signaling and trafficking. The Golgi apparatus is a nexus for lipid sorting and droplet biogenesis; small multi-pass modulators frequently seed neutral-lipid budding sites and coordinate coat/adaptor assemblies. This mechanistic placement explains lipid droplet formation (GO:0140042): by stabilizing budding microdomains at Golgi-derived membranes, the protein promotes nascent droplet assembly and maturation. The same Golgi-centered control propagates to cell physiology. By modulating cargo routing and signaling receptor turnover, the scaffold tunes pathways that govern proliferation and cell-cycle transitions, aligning with regulation of cell population proliferation (GO:0042127) and regulation of cell cycle (GO:0051726). Its influence on adhesion and cortical actin remodeling—achieved by recruiting or restraining actin regulators at membrane–cytoskeleton junctions—accounts for regulation of actin cytoskeleton organization (GO:0032956) and positive regulation of cell migration (GO:0030335). Thus, a single membrane-embedded binding module causally coordinates trafficking, cytoskeletal dynamics, and growth-control circuits.\n\nCellular localization follows directly from the domain-defined role and observed distribution. The small-integral-membrane modulators families are typically retained at secretory pathway stations; here, the protein concentrates at the Golgi apparatus (GO:0005794), consistent with a trafficking-and-lipid-droplet hub. Its soluble loops and cytosolic exposure explain cytoplasmic detection, and transient residence at the endoplasmic reticulum and nuclear envelope is expected for a polytopic factor that traffics within the ER–Golgi–nuclear envelope continuum.\n\nMechanistically, I hypothesize that the protein forms a Golgi-anchored oligomer that nucleates budding sites for lipid droplets and couples them to cytoskeletal remodeling. By binding coat/adaptor systems and actin regulators, it biases vesicle formation and cell-edge dynamics. Likely partners include Golgi matrix and trafficking modules (e.g., COPI/COPII adaptors and Golgi tethers), lipid droplet coat proteins, and actin-remodeling factors. Through these assemblies, the protein integrates membrane trafficking with cytoskeletal and cell-cycle pathways to control proliferation and migration.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-K7EJ46.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/K7EJ46"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/K7EJ46/entry","atlas":"/p/K7EJ46"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}