{"uniprot":"O15225","gene":"INE1","name":"Putative inactivation escape 1 protein","organism":"Homo sapiens (Human)","status":"dark","length":51,"sequence":"MSGPLSPVCSCPQLPFMLSPCHMHHHPGHVALSQTVSPASLLTQGLGLPQH","function_summary":"A nucleoplasmic adaptor that uses multivalent protein binding to assemble and modulate nuclear regulatory complexes controlling gene expression. By scaffolding transcriptional and RNA-processing assemblies inside the nucleus, it fine-tunes transcriptional output and co-transcriptional RNA maturation without direct catalytic activity, thereby shaping gene-expression programs from within the nucleoplasm.","plain_language":"INE1 has barely been studied. The model's best guess: A nucleoplasmic adaptor that uses multivalent protein binding to assemble and modulate nuclear regulatory complexes controlling gene expression. By scaffolding transcriptional and RNA-processing assemblies inside the nucleus, it fine-tunes transcriptional output and co-transcriptional RNA maturation without direct catalytic activity, thereby shaping gene-expression programs from within the nucleoplasm.","uniprot_summary":"Involved in the regulation of gene expression.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0010468","label":"regulation of gene expression"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding as a basal capability. The absence of catalytic InterPro signatures and the prominence of a generic binding annotation indicate a non-enzymatic scaffold or adaptor that organizes other macromolecules. Such binding-centric architectures typically mediate assembly and regulation of nuclear complexes rather than performing direct catalysis.\n\nFrom this binding-driven core, the most direct molecular function is multivalent protein association (GO:0005515 protein binding). A binding scaffold in the nucleus naturally influences transcriptional machinery and chromatin regulators. This causal role—organizing and modulating nuclear assemblies—aligns with GO:0010468 regulation of gene expression as the biological process: by recruiting or stabilizing transcription factors, co-regulators, and RNA-processing factors, the protein modulates transcriptional outputs and post-transcriptional fate without itself being enzymatic.\n\nCellular localization follows from function and sequence logic. A soluble, non-membranous binding scaffold that regulates gene expression is expected to concentrate in the nuclear interior where transcription and pre-mRNA processing occur. This places the protein in the nucleoplasm (GO:0005654 nucleoplasm), consistent with a nuclear residency. The nucleoplasmic environment provides access to transcriptional complexes, chromatin-bound assemblies, and spliceosomal components that collectively shape gene-expression programs.\n\nMechanistically, the protein likely operates as a nucleoplasmic adaptor that tunes gene-expression pathways by nucleating transient regulatory hubs. By concentrating transcriptional regulators and RNA-processing factors, it can bias promoter-proximal pause release, enhancer–promoter communication, or co-transcriptional splicing. This model predicts interaction with transcriptional co-regulators and chromatin remodelers rather than sequence-specific DNA-binding proteins. I therefore hypothesize partners among general transcription machinery (e.g., Mediator and RNA polymerase II-associated factors), chromatin-modifying complexes (such as histone acetyltransferase/deacetylase assemblies), and spliceosome-associated proteins. These interactions would allow the scaffold to coordinate transcriptional and post-transcriptional checkpoints that collectively regulate gene expression within the nucleoplasm.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-O15225.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/O15225"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/O15225/entry","atlas":"/p/O15225"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}