{"uniprot":"O43423","gene":"ANP32C","name":"Acidic leucine-rich nuclear phosphoprotein 32 family member C","organism":"Homo sapiens (Human)","status":"dark","length":234,"sequence":"MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDLPKLKLRKLELRVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCEVTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK","function_summary":"A phospho-regulated leucine-rich repeat scaffold that operates in the nucleus and perinuclear rim to coordinate chromatin assembly and RNA handling. By using an extended repeat platform to bind proteins and RNA, it stabilizes nucleosome assembly, organizes nuclear export pathways, and biases cargo flux toward perinuclear transport sites. This modular assembly role restrains cell differentiation and, under stress or developmental cues, promotes apoptotic signaling by facilitating caspase activation. The protein concentrates in the nucleoplasm and perinuclear cytoplasm and can transiently associate with endoplasmic reticulum–proximal RNA surveillance hubs.","plain_language":"ANP32C has barely been studied. The model's best guess: A phospho-regulated leucine-rich repeat scaffold that operates in the nucleus and perinuclear rim to coordinate chromatin assembly and RNA handling. By using an extended repeat platform to bind proteins and RNA, it stabilizes nucleosome assembly, organizes nuclear export pathways, and biases cargo flux toward perinuclear transport sites.","uniprot_summary":"May be involved in apoptosis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"},{"id":"GO:0003723","label":"RNA binding"}],"biological_process":[{"id":"GO:0045596","label":"negative regulation of cell differentiation"},{"id":"GO:0046827","label":"positive regulation of protein export from nucleus"},{"id":"GO:0006334","label":"nucleosome assembly"},{"id":"GO:0006919","label":"activation of cysteine-type endopeptidase activity involved in apoptotic process"}],"cellular_component":[{"id":"GO:0048471","label":"perinuclear region of cytoplasm"},{"id":"GO:0005654","label":"nucleoplasm"},{"id":"GO:0005783","label":"endoplasmic reticulum"}]},"interpro":[{"id":"IPR032675","name":"Leucine-rich repeat domain superfamily","type":"homologous_superfamily","start":1,"end":160},{"id":"IPR045081","name":"Acidic leucine-rich nuclear phosphoprotein 32","type":"family","start":3,"end":228},{"id":"IPR001611","name":"Leucine-rich repeat","type":"repeat","start":85,"end":106}],"reasoning":"I begin with the InterPro architecture. The N-terminal two-thirds of the polypeptide are covered by IPR032675 (Leucine-rich repeat domain superfamily, residues 1–160), and within this scaffold sits a discrete IPR001611 (Leucine-rich repeat, residues 85–106). This tandem of LRR superfamily and internal LRR repeat establishes a curved solenoid surface optimized for avid, multivalent macromolecular recognition rather than catalysis. Encompassing nearly the full length is IPR045081 (Acidic leucine-rich nuclear phosphoprotein 32 family, residues 3–228), which defines a nuclear, phospho-regulated scaffold class known to bind chromatin and RNA. The ordered layout—an extended LRR platform embedded in an acidic nuclear phosphoprotein family envelope—causally dictates a non-enzymatic, interaction-centric mechanism that uses modular binding to assemble and remodel ribonucleoprotein and chromatin complexes.\n\nThis LRR-centered scaffold explains two molecular functions. First, the repetitive LRR surface and acidic nuclear protein framework drive broad GO:0005515 protein binding by providing extensive interfaces for partners in chromatin and RNA pathways. Second, the acidic nuclear phosphoprotein family and LRR solenoid commonly engage ribonucleoprotein assemblies; together they support GO:0003723 RNA binding by stabilizing and positioning RNA within nuclear export and processing hubs.\n\nFrom these binding capabilities, the biological processes follow. The ability to chaperone histone-associated assemblies and stabilize nucleosome formation links directly to GO:0006334 nucleosome assembly; an LRR scaffold can present histone surfaces and guide deposition onto DNA. By organizing nuclear transport interfaces and coupling chromatin state to export adaptors, the same architecture promotes GO:0046827 positive regulation of protein export from nucleus; the scaffold can bias the flux of cargoes toward export pathways. The family’s propensity to interface with apoptotic regulators and to potentiate caspase cascades—through phospho-switches and RNA/chromatin remodeling that expose pro-apoptotic signals—accounts for GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process. Finally, by tuning transcriptional and chromatin environments that gate lineage commitment, the scaffold’s assembly and export activities yield GO:0045596 negative regulation of cell differentiation.\n\nCellular localization is dictated by function and architecture. The acidic nuclear phosphoprotein family and nucleosome assembly role place the protein in the GO:0005654 nucleoplasm, where chromatin and RNA processing occur. Its coupling to export and perinuclear trafficking explains accumulation in the GO:0048471 perinuclear region of cytoplasm, where nuclear pore complexes and cytoplasmic capture sites concentrate. Association with ribonucleoprotein maturation and quality control pathways rationalizes transient residence near the GO:0005783 endoplasmic reticulum, a perinuclear hub for RNA surveillance and stress signaling.\n\nMechanistically, I propose a phospho-regulated LRR scaffold that binds RNA and chromatin to coordinate nucleosome assembly and nuclear export. In the nucleus, it stabilizes histone–DNA complexes and recruits export adaptors; at the perinuclear rim, it biases cargo toward outward transport. Under stress or developmental cues, this platform shifts toward apoptotic signaling—potentiating caspase activation—thereby restraining differentiation. Likely interaction partners include nucleosome assembly factors and histones in the nucleus; nuclear pore and export adaptors at the periphery; and apoptotic regulators that sense chromatin and RNA remodeling states. Together, these interactions produce a switchable hub that couples chromatin assembly, RNA handling, and cell-fate control across nucleoplasm and perinuclear territories.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-O43423.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/O43423"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/O43423/entry","atlas":"/p/O43423"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}