{"uniprot":"O75971","gene":"SNAPC5","name":"snRNA-activating protein complex subunit 5","organism":"Homo sapiens (Human)","status":"dark","length":98,"sequence":"MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSHDMLVHVDNEASINQTTLELSTKSHVTEEEEEEEEEESDS","function_summary":"A nuclear assembly factor that forms part of the snRNA-activating complex and organizes preinitiation scaffolds at small nuclear RNA promoters. By mediating multivalent protein interactions rather than catalysis, it stabilizes promoter-bound assemblies that drive snRNA gene transcription and interfaces with pathways that also produce small RNAs. Its activity concentrates within nuclear bodies and the nucleolus, where it helps recruit and coordinate initiation machinery for RNA polymerase II– and III–dependent transcription steps integral to snRNA biogenesis.","plain_language":"SNAPC5 has barely been studied. The model's best guess: A nuclear assembly factor that forms part of the snRNA-activating complex and organizes preinitiation scaffolds at small nuclear RNA promoters. By mediating multivalent protein interactions rather than catalysis, it stabilizes promoter-bound assemblies that drive snRNA gene transcription and interfaces with pathways that also produce small RNAs.","uniprot_summary":"Component of the snRNA-activating protein complex (SNAPc) that mediates snRNA transcription by RNA polymerase II and III.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"},{"id":"GO:0000995","label":"RNA polymerase III general transcription initiation factor activity"},{"id":"GO:0016251","label":"RNA polymerase II general transcription initiation factor activity"}],"biological_process":[{"id":"GO:0042795","label":"snRNA transcription by RNA polymerase II"},{"id":"GO:0006366","label":"transcription by RNA polymerase II"},{"id":"GO:0006383","label":"transcription by RNA polymerase III"},{"id":"GO:0009301","label":"snRNA transcription"}],"cellular_component":[{"id":"GO:0016604","label":"nuclear body"},{"id":"GO:0005730","label":"nucleolus"}]},"interpro":[{"id":"IPR029138","name":"snRNA-activating protein complex subunit 5","type":"family","start":1,"end":97}],"reasoning":"I begin with the InterPro architecture: IPR029138 (snRNA-activating protein complex subunit 5 family) spans residues 1–97 and covers essentially the entire polypeptide. A single, full-length family signature that defines SNAPc subunit 5 indicates a dedicated, non-enzymatic component of the small nuclear RNA-activating complex. Such SNAPc5-family proteins typically form obligate subcomplexes that scaffold other factors rather than catalyze reactions. This architecture therefore enforces a role centered on macromolecular assembly and nucleic-acid-associated initiation, not enzymology.\n\nFrom this scaffold-like core, I infer molecular function. The SNAPc5 family is a defining element of the initiation apparatus that nucleates snRNA promoter assembly. This causes two complementary general transcription initiation factor activities: it supports RNA polymerase II-dependent initiation at snRNA promoters (GO:0016251 RNA polymerase II general transcription initiation factor activity) and contributes to RNA polymerase III-dependent initiation pathways that interface with small-RNA biogenesis (GO:0000995 RNA polymerase III general transcription initiation factor activity). The absence of catalytic motifs and the presence of a complex-dedicated family domain point to multivalent protein-protein interfaces, consistent with GO:0005515 protein binding as a basal capability that enables assembly of the preinitiation complex.\n\nThese initiation activities map directly to biological process. By stabilizing promoter-bound assemblies for small nuclear RNA genes, the protein drives snRNA transcription by RNA polymerase II (GO:0042795) and participates in the broader program of snRNA transcription (GO:0009301). Its coupling to polymerase III pathways and shared nucleic-acid response modules explains its role in RNA polymerase III transcription (GO:0006383), reflecting the functional crosstalk between snRNA and tRNA/5S RNA production systems.\n\nCellular localization follows from function and known assembly hubs. The snRNA-activating complex operates within nuclear substructures that concentrate transcription and RNA processing machinery. The architecture and role predict residence in nuclear bodies (GO:0016604), where snRNA and polymerase III-related assemblies cluster, and in the nucleolus (GO:0005730), a neighboring hub for small-RNA biogenesis and factor exchange. This nuclear focus aligns with a soluble, chromatin-proximal environment that seeds snRNA transcription.\n\nMechanistically, I hypothesize that SNAPc5 forms a structural node that stabilizes SNAPc with other subunits at snRNA promoters. By binding partner proteins, it positions promoter-recognition modules and recruits polymerase-specific initiation factors. Likely partners include other SNAPc subunits and promoter-binding adaptors that bridge to polymerase II or III assemblies. Through these interactions, the complex nucleates a preinitiation scaffold that coordinates snRNA gene transcription within nuclear bodies and the nucleolus.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-O75971.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/O75971"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/O75971/entry","atlas":"/p/O75971"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}