{"uniprot":"O76042","gene":"ERC2-IT1","name":"Putative uncharacterized protein encoded by ERC2-IT1","organism":"Homo sapiens (Human)","status":"dark","length":136,"sequence":"MLACFPCFLRRKMPCLLKVADAGCSVGLGKVHCSCHLPNPRVLRHCDILTGVLTLGLDMSCHACLSAGTGLGEELVGLGPGSTCLVKHLWLLFPCHRLASQNYSDSLAQQWSFSLLIMWLCNREREIFMSKCAKCI","function_summary":"A nuclear transcriptional modulator that uses multivalent protein-binding capacity to assemble and tune regulatory complexes controlling gene expression. Operating within the nucleoplasm, it likely functions as a soluble adaptor that recruits transcription factors and chromatin-modifying partners to adjust promoter-proximal and enhancer-mediated activities. By scaffolding these assemblies rather than catalyzing reactions, it integrates upstream signaling cues into precise transcriptional outputs.","plain_language":"ERC2-IT1 has barely been studied. The model's best guess: A nuclear transcriptional modulator that uses multivalent protein-binding capacity to assemble and tune regulatory complexes controlling gene expression. Operating within the nucleoplasm, it likely functions as a soluble adaptor that recruits transcription factors and chromatin-modifying partners to adjust promoter-proximal and enhancer-mediated activities.","uniprot_summary":"Transcriptional modulator.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0010468","label":"regulation of gene expression"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding as a basal capability. The absence of catalytic InterPro signatures and the prominence of a generic binding annotation indicate a non-enzymatic scaffold/adaptor whose primary role is to form and stabilize multiprotein assemblies. Such adaptors often tune transcriptional programs by docking to transcription factors and chromatin regulators rather than catalyzing reactions themselves.\n\nFrom this binding-centric core, I infer molecular function first. A protein whose defining feature is broad protein-binding capacity (GO:0005515) typically mediates selective assembly of regulatory complexes. This architecture causes regulation of gene expression by recruiting and positioning transcriptional machinery and chromatin-modifying partners, aligning with GO:0010468 regulation of gene expression as the operative biological process. The functional label “transcriptional modulator” is mechanistically consistent with a scaffold that fine-tunes transcriptional outputs without directly binding DNA or catalyzing RNA synthesis.\n\nCellular placement follows from the process and architecture. A transcriptional modulator must access transcriptional complexes and chromatin; thus it operates in the nuclear interior. The most precise compartment is the nucleoplasm (GO:0005654), where transcription factors, co-regulators, and RNA polymerase II assemble and exchange. The stated nuclear localization supports this soluble intranuclear residence rather than membrane or cytoplasmic compartments.\n\nThese features together suggest a mechanism: the protein acts as a nucleoplasmic adaptor that organizes transcriptional assemblies and couples them to signaling pathways. By concentrating transcription factors and co-regulators, it modulates promoter-proximal events and enhancer–promoter communication. This scaffolding role explains how a binding-driven architecture can regulate gene expression without intrinsic enzymatic activity.\n\nGiven this model, I hypothesize interaction partners that fit the mechanism. Likely associates include sequence-specific transcription factors and their co-regulators, mediator and RNA polymerase II subunits, and chromatin-modifying complexes (e.g., histone acetyltransferases and deacetylases). To bridge nuclear programs with extracellular cues, transient contacts with signal-activated transcription factors (such as NF-κB or STAT family members) are expected. These interactions would allow the protein to translate signaling states into graded transcriptional outputs within the nucleoplasm.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-O76042.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/O76042"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/O76042/entry","atlas":"/p/O76042"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}