{"uniprot":"P01593","gene":"IGKV1D-33","name":"Immunoglobulin kappa variable 1D-33","organism":"Homo sapiens (Human)","status":"dark","length":117,"sequence":"MDMRVPAQLLGLLLLWLSGARCDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP","function_summary":"A human immunoglobulin light-chain variable region that forms a beta-sandwich recognition module for antigen binding. By pairing with heavy-chain variable and constant regions, it creates the high-affinity binding site that initiates receptor signaling on B cells and drives neutralization when secreted. Its stable immunoglobulin fold supports oligomerization and assembly with other immunoglobulin components, explaining its presence at the cell surface and in extracellular vesicles and blood microparticles. Through shaping antigen handling and immune complex formation, it contributes to humoral defense and indirectly influences filtration dynamics in the kidney.","plain_language":"IGKV1D-33 has barely been studied. The model's best guess: A human immunoglobulin light-chain variable region that forms a beta-sandwich recognition module for antigen binding. By pairing with heavy-chain variable and constant regions, it creates the high-affinity binding site that initiates receptor signaling on B cells and drives neutralization when secreted.","uniprot_summary":"V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B-lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B-lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens.","go_terms":{"molecular_function":[{"id":"GO:0042802","label":"identical protein binding"}],"biological_process":[{"id":"GO:0003094","label":"glomerular filtration"}],"cellular_component":[{"id":"GO:0072562","label":"blood microparticle"},{"id":"GO:0070062","label":"extracellular exosome"},{"id":"GO:0005886","label":"plasma membrane"}]},"interpro":[{"id":"IPR013783","name":"Immunoglobulin-like fold","type":"homologous_superfamily","start":15,"end":116},{"id":"IPR036179","name":"Immunoglobulin-like domain superfamily","type":"homologous_superfamily","start":24,"end":115},{"id":"IPR007110","name":"Immunoglobulin-like domain","type":"domain","start":24,"end":117},{"id":"IPR013106","name":"Immunoglobulin V-set domain","type":"domain","start":28,"end":112},{"id":"IPR003599","name":"Immunoglobulin domain subtype","type":"domain","start":30,"end":116},{"id":"IPR050150","name":"Immunoglobulin Variable Light Chain","type":"family","start":22,"end":113}],"reasoning":"I begin with the InterPro architecture, which is uniformly immunoglobulin-like across the core of the polypeptide. IPR013783 (Immunoglobulin-like fold, residues 15–116) and IPR036179 (Immunoglobulin-like domain superfamily, residues 24–115) define a beta-sandwich scaffold typical of Ig domains. Within this scaffold, IPR007110 (Immunoglobulin-like domain, residues 24–117) and IPR013106 (Immunoglobulin V-set domain, residues 28–112) specify a V-set Ig domain that forms the variable antigen-recognition module. IPR003599 (Immunoglobulin domain subtype, residues 30–116) refines the subtype, and IPR050150 (Immunoglobulin Variable Light Chain family, residues 22–113) assigns the sequence to the variable region of light chains. The ordered layout—an Ig V-set domain embedded in the broader immunoglobulin-like fold—creates a rigid beta-sandwich that presents hypervariable loops for high-affinity binding to diverse antigens.\n\nThis V-set architecture causes molecular recognition rather than catalysis. The beta-sandwich stabilizes complementarity-determining regions that mediate selective binding; such modules frequently self-associate or oligomerize in solution, which supports GO:0042802 identical protein binding as a molecular function. The absence of enzymatic motifs and the presence of a canonical Ig binding surface further argue that the primary role is high-specificity ligand recognition and assembly with other immunoglobulin components.\n\nFrom this molecular function, the biological role follows. Antigen recognition by the variable light chain drives humoral immunity by forming antigen-bound complexes that initiate signaling when displayed as a membrane receptor or that are secreted to neutralize soluble targets. This immunoglobulin-driven recognition contributes to organismal defense pathways that intersect with renal physiology; specifically, glomerular filtration (GO:0003094) depends on tight control of circulating immune complexes and filtration barrier integrity. By shaping antigen handling and immune complex formation, the light-chain variable region indirectly influences filtration dynamics through its extracellular trafficking and binding properties.\n\nCellular localization is dictated by the two operational states of immunoglobulins. In one state, the variable region is part of a membrane-bound receptor on B cells, placing the complex at the plasma membrane (GO:0005886). In the other state, it is secreted into extracellular fluids and frequently circulates within extracellular vesicles and particles, aligning with extracellular exosome (GO:0070062) and blood microparticle (GO:0072562). The Ig fold’s stability and avidity for extracellular ligands explain its persistence in these compartments.\n\nMechanistically, the variable light chain pairs with heavy-chain variable and constant domains to form a composite antigen-binding site. This composite site nucleates higher-order assemblies: membrane-bound assemblies trigger B-cell signaling, while secreted assemblies neutralize antigen and guide downstream effector pathways. I therefore hypothesize that this variable light chain associates with immunoglobulin heavy chains and B-cell receptor scaffolds, and in extracellular fluids it likely engages antigen and immune-complex carriers that are packaged into vesicles and circulating particles. These assemblies collectively tune antigen clearance and maintain filtration homeostasis through controlled immune complex formation and handling.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-P01593.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/P01593"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/P01593/entry","atlas":"/p/P01593"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}