{"uniprot":"P03928","gene":"MT-ATP8","name":"ATP synthase protein 8","organism":"Homo sapiens (Human)","status":"dark","length":68,"sequence":"MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS","function_summary":"A small, multi-pass membrane component of the mitochondrial ATP synthase that embeds within the inner membrane to stabilize the membrane sector and its stator interface. By binding neighboring subunits and reinforcing the architecture that conducts protons and transmits torque, it enables efficient coupling of proton flow to rotary catalysis and ATP production during oxidative phosphorylation. Its role is structural and organizational rather than catalytic, ensuring the integrity and assembly of the rotary machine within the inner membrane.","plain_language":"MT-ATP8 has barely been studied. The model's best guess: A small, multi-pass membrane component of the mitochondrial ATP synthase that embeds within the inner membrane to stabilize the membrane sector and its stator interface. By binding neighboring subunits and reinforcing the architecture that conducts protons and transmits torque, it enables efficient coupling of proton flow to rotary catalysis and ATP production during oxidative phosphorylation.","uniprot_summary":"Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"},{"id":"GO:0046933","label":"proton-transporting ATP synthase activity, rotational mechanism"}],"biological_process":[{"id":"GO:0042776","label":"proton motive force-driven mitochondrial ATP synthesis"}],"cellular_component":[{"id":"GO:0005753","label":"mitochondrial proton-transporting ATP synthase complex"}]},"interpro":[{"id":"IPR001421","name":"ATP synthase F(0) complex subunit 8","type":"family","start":1,"end":55},{"id":"IPR039017","name":"ATP synthase protein 8, mammals","type":"family","start":1,"end":68}],"reasoning":"I begin with the InterPro architecture. The sequence is fully covered by two family-level signatures: IPR001421 (ATP synthase F(0) complex subunit 8 family, residues 1–55) and IPR039017 (ATP synthase protein 8, mammals family, residues 1–68). The overlap and N-terminal-to-C-terminal coverage indicate a compact, highly hydrophobic membrane protein characteristic of the small stator-associated components of mitochondrial F0. This architecture dictates a multi-pass topology that embeds within the inner membrane and packs against other F0 elements. Such small hydrophobic subunits lack catalytic motifs but are essential for assembly and mechanical coupling of the rotary ATP synthase.\n\nFrom this architecture, the molecular function resolves along two axes. First, the absence of catalytic residues and the presence of a membrane-embedded scaffold strongly support GO:0005515 protein binding as the operative mode—this subunit binds neighboring F0 and stator elements to stabilize the machine. Second, by being an obligate component of the F0 sector that executes proton translocation coupled to rotation, it contributes to GO:0046933 proton-transporting ATP synthase activity, rotational mechanism. Its role is not to bind or hydrolyze ATP directly but to enable the proton pathway and rotational coupling by maintaining the integrity and geometry of the membrane-embedded assembly.\n\nThese molecular functions causally feed into mitochondrial energy conversion. By stabilizing and tuning the F0 proton channel and its interface with the rotary apparatus, the subunit ensures efficient GO:0042776 proton motive force-driven mitochondrial ATP synthesis. This places the protein squarely within oxidative phosphorylation, where the proton gradient generated by the respiratory chain is converted into ATP through the rotary mechanism.\n\nThe cellular context follows directly. The family signatures specific to F0 subunit 8, together with the hydrophobic architecture, place the protein in the mitochondrial inner membrane as a multi-pass membrane component. This situates it within GO:0005753 mitochondrial proton-transporting ATP synthase complex and, more broadly, the inner membrane system that houses oxidative phosphorylation machinery.\n\nMechanistically, I infer that this subunit forms a rigidifying strut within F0 that buttresses the proton-conducting pathway and the peripheral stalk. By binding to adjacent membrane subunits and the stator assembly, it constrains relative motions that are essential for torque transmission from F0 to F1. Likely interaction partners include other F0 membrane proteins that shape the proton channel and the stator interface—particularly the large membrane subunit that forms the rotor–stator junction and the peripheral stalk constituents that anchor the catalytic head. Together, these contacts enforce the precise geometry required for proton translocation to drive rotary catalysis and ATP production.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-P03928.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/P03928"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/P03928/entry","atlas":"/p/P03928"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}