{"uniprot":"P0C263","gene":"SBK2","name":"Serine/threonine-protein kinase SBK2","organism":"Homo sapiens (Human)","status":"dark","length":348,"sequence":"MPGKQSEEGPAEAGASEDSEEEGLGGLTLEELQQGQEAARALEDMMTLSAQTLVRAEVDELYEEVRPLGQGCYGRVLLVTHRQKGTPLALKQLPKPRTSLRGFLYEFCVGLSLGAHSAIVTAYGIGIESAHSYSFLTEPVLHGDLMAFIQPKVGLPQPAVHRCAAQLASALEYIHARGLVYRDLKPENVLVCDPACRRFKLTDFGHTRPRGTLLRLAGPPIPYTAPELCAPPPLPEGLPIQPALDAWALGVLLFCLLTGYFPWDRPLAEADPFYEDFLIWQASGQPRDRPQPWFGLAAAADALLRGLLDPHPRRRSAVIAIREHLGRPWRQREGEAEAVGAVEEEAGQ","function_summary":"A human cytosolic serine/threonine kinase that uses a canonical bilobal catalytic core to bind ATP and phosphorylate target proteins, thereby driving signaling pathways that regulate membrane trafficking and cargo sorting near the Golgi apparatus. By transiently associating with Golgi-proximal assemblies, it modifies trafficking and scaffolding factors to coordinate vesicle formation and delivery, operating primarily in the cytosol with dynamic recruitment to perinuclear secretory hubs.","plain_language":"SBK2 has barely been studied. The model's best guess: A human cytosolic serine/threonine kinase that uses a canonical bilobal catalytic core to bind ATP and phosphorylate target proteins, thereby driving signaling pathways that regulate membrane trafficking and cargo sorting near the Golgi apparatus. By transiently associating with Golgi-proximal assemblies, it modifies trafficking and scaffolding factors to coordinate vesicle formation and delivery, operating primarily in the cytosol with dynamic recruitment to perinuclear secretory hubs.","uniprot_summary":"May be involved in signal transduction pathways.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"},{"id":"GO:0004674","label":"protein serine/threonine kinase activity"}],"biological_process":[{"id":"GO:0006468","label":"protein phosphorylation"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005794","label":"Golgi apparatus"}]},"interpro":[{"id":"IPR011009","name":"Protein kinase-like domain superfamily","type":"homologous_superfamily","start":59,"end":324},{"id":"IPR000719","name":"Protein kinase domain","type":"domain","start":62,"end":330},{"id":"IPR017441","name":"Protein kinase, ATP binding site","type":"binding_site","start":68,"end":91},{"id":"IPR008271","name":"Serine/threonine-protein kinase, active site","type":"active_site","start":179,"end":191}],"reasoning":"I begin with the InterPro architecture. The core of the protein is a canonical bilobal kinase module: IPR011009 (Protein kinase-like domain superfamily, residues 59–324) encompasses IPR000719 (Protein kinase domain, residues 62–330), establishing a eukaryotic protein kinase fold. Within this fold, IPR017441 (Protein kinase, ATP binding site, residues 68–91) marks the glycine-rich loop and adenine-binding pocket that secure ATP, while IPR008271 (Serine/threonine-protein kinase, active site, residues 179–191) pinpoints the catalytic loop and activation segment that position the substrate hydroxyl for transfer of the gamma-phosphate. This ordered arrangement—ATP-binding cradle leading into a serine/threonine catalytic center—causally defines a phosphotransferase that modifies serine/threonine residues and necessitates transient protein–protein contacts for substrate docking and regulation.\n\nFrom this architecture, the molecular function resolves into two facets. First, the intact catalytic core and conserved motifs specify GO:0004674 protein serine/threonine kinase activity. Second, the reliance on docking grooves and regulatory interactions inherent to eukaryotic kinases supports GO:0005515 protein binding as an intrinsic property that enables substrate selection and scaffold engagement.\n\nCatalytic phosphorylation directly situates the protein in GO:0006468 protein phosphorylation as its biological process. The kinase chemistry—ATP capture via residues 68–91 followed by activation-loop–assisted transfer centered at residues 179–191—drives signaling cascades that tune trafficking and cytoskeletal pathways. Such cascades often coordinate vesicle budding and cargo sorting.\n\nCellular placement follows from function and sequence context. The soluble kinase fold and absence of transmembrane features argue for a cytosolic enzyme, aligning with GO:0005829 cytosol. Kinase-mediated control of cargo sorting and membrane traffic further predicts association with perinuclear secretory organelles; thus, transient residency or action at the GO:0005794 Golgi apparatus is expected. A cytosol-to-Golgi axis allows the enzyme to phosphorylate Golgi-proximal substrates and adaptors without being a resident membrane protein.\n\nMechanistically, the kinase likely cycles between cytosolic pools and Golgi-proximal assemblies, where it phosphorylates trafficking factors to modulate vesicle formation and delivery. I hypothesize that adaptor complexes and small GTPases recruit the kinase to Golgi-associated platforms, where substrate docking is enforced by short linear motifs and scaffold interactions. In this setting, plausible partners include clathrin/adaptor modules and ARF/Rab GTPases that concentrate cargo and curvature machinery; phosphorylation by this kinase would fine-tune assembly kinetics and fidelity of membrane transport pathways.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-P0C263.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/P0C263"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/P0C263/entry","atlas":"/p/P0C263"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}