{"uniprot":"P0C6T2","gene":"OST4","name":"Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4","organism":"Homo sapiens (Human)","status":"dark","length":37,"sequence":"MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE","function_summary":"A small endoplasmic reticulum membrane subunit of the oligosaccharyltransferase that stabilizes and organizes the glycosylation machinery responsible for co-translational N-glycan transfer to nascent polypeptides. By mediating subunit–subunit contacts within the membrane-embedded assembly, it helps position the catalytic core near the translocon to ensure efficient installation of the lipid-linked oligosaccharide onto asparagine residues during N-linked glycosylation.","plain_language":"OST4 has barely been studied. The model's best guess: A small endoplasmic reticulum membrane subunit of the oligosaccharyltransferase that stabilizes and organizes the glycosylation machinery responsible for co-translational N-glycan transfer to nascent polypeptides. By mediating subunit–subunit contacts within the membrane-embedded assembly, it helps position the catalytic core near the translocon to ensure efficient installation of the lipid-linked oligosaccharide onto asparagine residues during N-linked glycosylation.","uniprot_summary":"Involved in protein N-glycosylation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0018279","label":"protein N-linked glycosylation via asparagine"}],"cellular_component":[{"id":"GO:0008250","label":"oligosaccharyltransferase complex"},{"id":"GO:0005789","label":"endoplasmic reticulum membrane"}]},"interpro":[{"id":"IPR036330","name":"Oligosaccharyltransferase subunit ost4p superfamily","type":"homologous_superfamily","start":1,"end":35},{"id":"IPR018943","name":"Oligosaccaryltransferase","type":"family","start":1,"end":32},{"id":"IPR051307","name":"Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4, fungi and metazoa","type":"family","start":1,"end":37}],"reasoning":"I begin with the InterPro architecture. Three overlapping signatures span essentially the entire polypeptide: IPR036330 (Oligosaccharyltransferase subunit ost4p superfamily, residues 1–35), IPR018943 (Oligosaccharyltransferase family, residues 1–32), and IPR051307 (Dolichyl-diphosphooligosaccharide–protein glycosyltransferase subunit 4, fungi and metazoa family, residues 1–37). The complete coverage and tight length range indicate a very small, highly conserved membrane subunit characteristic of eukaryotic OST complexes rather than a catalytic enzyme. The absence of catalytic motifs and the dominance of OST subunit families together argue that this protein functions through structural and assembly roles that stabilize and position the catalytic core of the OST machinery.\n\nFrom this architecture, the molecular function resolves as protein binding (GO:0005515). A compact, hydrophobic OST-4-like module is optimized to mediate subunit–subunit contacts and anchor the larger catalytic assembly. Such binding activity is necessary to maintain the integrity and topology of the OST complex within the endoplasmic reticulum membrane.\n\nThis binding role causally supports the biological process of protein N-linked glycosylation via asparagine (GO:0018279). By stabilizing the OST ensemble that transfers the defined lipid-linked oligosaccharide to Asn residues in nascent polypeptides, this subunit ensures efficient and accurate N-glycan installation during co-translational translocation. The OST pathway uses a defined glycan donor; the OST-4-like architecture positions and preserves the catalytic environment that executes this transfer.\n\nThe cellular context follows directly. The OST complex is a membrane-embedded assembly; thus the protein resides in the endoplasmic reticulum membrane and constitutes part of the oligosaccharyltransferase complex. These assignments align with the formal cellular components GO:0005789 endoplasmic reticulum membrane and GO:0008250 oligosaccharyltransferase complex. The small size and predicted single-pass nature of OST-4-like proteins favor a monotopic or single-pass topology that buttresses other OST subunits within the ER bilayer.\n\nMechanistically, I hypothesize that this subunit nucleates or stabilizes the OST assembly adjacent to the Sec61 translocon, positioning the catalytic subunit to receive the dolichyl-diphosphooligosaccharide donor and transfer it to acceptor asparagine within emerging polypeptides. Likely interaction partners include the core catalytic and scaffolding OST subunits and the translocation apparatus; transient contacts with ribosome–nascent-chain complexes and ER-resident chaperones would further coordinate glycosylation with protein maturation.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-P0C6T2.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/P0C6T2"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/P0C6T2/entry","atlas":"/p/P0C6T2"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}