{"uniprot":"P0C7L1","gene":"SPINK8","name":"Serine protease inhibitor Kazal-type 8","organism":"Homo sapiens (Human)","status":"dark","length":97,"sequence":"MKGICSDAILVLATSMWMAFAIDFPLPMASERGQLDKTIVECLKNVNKCWFLSYIKPSEPICGSDQVTYSSDCHLCSKILFEGLNITKLYDGQCENS","function_summary":"A secreted Kazal-type protease inhibitor that operates in the reproductive tract and sperm lineage. By using a disulfide-stabilized inhibitory module to bind and restrain serine proteases, it tunes proteolytic processing during acrosome biogenesis and membrane remodeling in sperm, thereby coordinating late steps of germ cell maturation. The same inhibitory mechanism likely dampens inflammatory protease cascades that shape cytokine output and reproductive tissue signaling, linking sperm-acrosomal control with broader effects on proliferation, ovulation, and immunomodulation. It is secreted and associates with the acrosomal vesicle during spermiogenesis.","plain_language":"SPINK8 has barely been studied. The model's best guess: A secreted Kazal-type protease inhibitor that operates in the reproductive tract and sperm lineage. By using a disulfide-stabilized inhibitory module to bind and restrain serine proteases, it tunes proteolytic processing during acrosome biogenesis and membrane remodeling in sperm, thereby coordinating late steps of germ cell maturation.","uniprot_summary":"May be involved in acrosome formation or some other membrane-related events that occur during sperm development or function.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0060278","label":"regulation of ovulation"},{"id":"GO:0032656","label":"negative regulation of interleukin-12 production"},{"id":"GO:0008284","label":"positive regulation of cell population proliferation"},{"id":"GO:1903430","label":"negative regulation of cell maturation"}],"cellular_component":[{"id":"GO:0001669","label":"acrosomal vesicle"}]},"interpro":[{"id":"IPR036058","name":"Kazal domain superfamily","type":"homologous_superfamily","start":48,"end":95},{"id":"IPR002350","name":"Kazal domain","type":"domain","start":36,"end":96}],"reasoning":"I begin with the InterPro architecture: a single inhibitory module dominates the sequence. IPR002350 (Kazal domain, residues 36–96) is a classical secreted protease-inhibitor fold that binds and blocks the active sites of serine endopeptidases through a canonical reactive loop. This domain sits within IPR036058 (Kazal domain superfamily, residues 48–95), reinforcing that the core of the protein is a disulfide-stabilized Kazal inhibitory unit. The ordered layout—one compact Kazal module without additional catalytic or transmembrane features—dictates a soluble, secreted inhibitor that exerts function via high-affinity protein binding rather than enzymatic catalysis. This architecture causes a molecular function centered on GO:0005515 protein binding, with binding specificity biased toward serine proteases and their zymogen/precursor partners by the Kazal scaffold.\n\nFrom this inhibitory binding mechanism, I infer the biological roles that such a secreted Kazal protein can modulate. In the male germline, proteolytic processing governs acrosome biogenesis and membrane remodeling. A Kazal inhibitor positioned in the acrosomal pathway would tune protease activity to control acrosomal vesicle dynamics and subsequent membrane fusion events. This causal link supports acrosomal vesicle residency and explains how the same inhibitory module can both restrain and temporally coordinate proteolysis. Such control aligns with GO:1903430 negative regulation of cell maturation, because precise protease inhibition can pause terminal differentiation steps until acrosome-related maturation is complete. The same inhibitory logic extends to GO:0008284 positive regulation of cell population proliferation in spermatogonial or Sertoli-lineage contexts, where restrained protease signaling can favor proliferative niches.\n\nIn the immune milieu of the testis and epididymis, a secreted Kazal inhibitor can dampen inflammatory cascades by limiting protease-driven cytokine maturation or activation. This mechanism accounts for GO:0032656 negative regulation of interleukin-12 production: by curbing protease cascades upstream of cytokine processing or receptor engagement, the inhibitor reduces IL-12 output. The same secreted inhibitory paradigm can influence female fertility pathways. By modulating extracellular proteolysis and matrix cues that govern follicular growth and oocyte release, the protein can contribute to GO:0060278 regulation of ovulation, with bidirectional effects plausible: restraining protease activity may delay ovulatory signaling in some contexts while supporting acrosome-related cues that ultimately intersect with ovulation pathways.\n\nCellular localization follows directly from the domain and process logic. The absence of transmembrane segments and the presence of a secreted inhibitory module point to extracellular deployment. The acrosomal vesicle association is supported by the need for tightly timed protease inhibition during sperm acrosome maturation, matching GO:0001669 acrosomal vesicle. Secretory routing explains the experimentally observed secreted status and the acrosomal vesicle residency during spermiogenesis.\n\nMechanistically, I hypothesize that the Kazal domain binds and inhibits trypsin-like serine proteases and their zymogens in the acrosomal and reproductive tract environments. Likely partners include acrosome-associated proteases and processing factors (e.g., acrosomal serine proteases and their precursors), as well as extracellular matrix–associated proteases that shape cytokine production. Through transient high-affinity binding, the inhibitor sets thresholds for proteolytic cascades that coordinate acrosome formation, sperm maturation, proliferative signaling in supporting cells, and immunomodulation that impacts ovulation and IL-12 output.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-P0C7L1.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/P0C7L1"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/P0C7L1/entry","atlas":"/p/P0C7L1"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}