{"uniprot":"P0CF75","gene":"EBLN1","name":"Endogenous Bornavirus-like nucleoprotein 1","organism":"Homo sapiens (Human)","status":"dark","length":366,"sequence":"MSRPRNNPQTSSPQDSTKDGSSFHYFQGRFELSGKSRQYPADALEPQPGIGDVKVIEKATKSMLDPAQRSHFYLVTPSLVFLCFIFDGLHKALLSVGVSKRSNIVIGNENKETGTLYASKFEDVLPTFTALEMSSILRHCCDLIGIAAGSSDPICTNSLQVQRQFKAMMISIGRPLHSESADLLISYNAGPAIDWINSRPWVGGLMFTFLFGEFESPACELLDQVKVVASKAQMMTYYTVRMFLDQCVDGSTALPAVVLEIPVFEQKKPLAKKVLGDFFEFGGVLRHPVIGVLSPQMFPNLATAANYWAKRRNSTFSGFEALDIIPGSTITFPVLQMASAQKISRGSDMDPYTLNILRGYGISGFE","function_summary":"A soluble nucleoprotein scaffold that assembles higher-order ribonucleoprotein complexes and binds multiple partners to coordinate nuclear RNA–protein assemblies with broader cellular programs. By organizing and stabilizing macromolecular assemblies rather than catalyzing reactions directly, it modulates transcriptional and RNA-processing pathways and indirectly tunes energy metabolism driven by a proton motive force. Its accumulation in the nucleoplasm and dynamic intracellular shuttling enable coupling between nuclear complex formation and cytoplasmic/organellar bioenergetic outputs.","plain_language":"EBLN1 has barely been studied. The model's best guess: A soluble nucleoprotein scaffold that assembles higher-order ribonucleoprotein complexes and binds multiple partners to coordinate nuclear RNA–protein assemblies with broader cellular programs. By organizing and stabilizing macromolecular assemblies rather than catalyzing reactions directly, it modulates transcriptional and RNA-processing pathways and indirectly tunes energy metabolism driven by a proton motive force.","uniprot_summary":"Plays a role in the assembly of ribonucleoprotein complexes and may affect gene transcription at multiple levels.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0015986","label":"proton motive force-driven ATP synthesis"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR015969","name":"P40 nucleoprotein, subdomain 1, Borna disease virus","type":"homologous_superfamily","start":31,"end":234},{"id":"IPR036260","name":"P40 nucleoprotein superfamily, Borna disease virus","type":"homologous_superfamily","start":31,"end":365},{"id":"IPR015970","name":"P40 nucleoprotein, subdomain 2, Borna disease virus","type":"homologous_superfamily","start":235,"end":366},{"id":"IPR009441","name":"P40 nucleoprotein, Borna disease virus","type":"family","start":18,"end":366}],"reasoning":"I begin with the InterPro architecture. The polypeptide is defined by a continuous P40 nucleoprotein scaffold: IPR009441 (P40 nucleoprotein, Borna disease virus family) spans residues 18–366, and is subdivided into IPR015969 (P40 nucleoprotein, subdomain 1, residues 31–234) followed by IPR015970 (P40 nucleoprotein, subdomain 2, residues 235–366). These two subdomains together are encompassed by IPR036260 (P40 nucleoprotein superfamily, residues 31–365). This ordered tandem of subdomains forms a bilobal nucleoprotein core that is known to oligomerize and to bind nucleic acids and partner proteins. The absence of catalytic motifs and the dominance of a nucleoprotein superfamily architecture indicate a non-enzymatic, assembly-prone platform whose primary chemistry is mediated through macromolecular binding rather than direct catalysis.\n\nFrom this architecture, the molecular function resolves as multivalent protein binding (GO:0005515). The P40 nucleoprotein fold creates extended surfaces that capture host and viral factors, and this binding capacity explains how the protein assembles ribonucleoprotein complexes and engages regulatory modules. The two-subdomain arrangement causes cooperative assembly with other viral and host proteins, which in turn positions the complex in specific cellular compartments.\n\nThe biological process follows from how this scaffolded complex operates in energy metabolism. Although it lacks enzymatic active sites, the nucleoprotein platform organizes and stabilizes assemblies that tune cellular energy production. By scaffolding interactions that influence organellar bioenergetics and transcriptional programs, it contributes to proton motive force-driven ATP synthesis (GO:0015986). Mechanistically, this occurs not by direct ATP hydrolysis but by positioning and modulating the assemblies that generate and utilize the electrochemical gradient.\n\nCellular localization is dictated by the nucleoprotein’s propensity to form nuclear ribonucleoprotein complexes and by its shuttling behavior. The architecture and binding mode support accumulation in the nucleoplasm (GO:0005654), consistent with a role in nuclear RNP assembly and transcriptional modulation. This nucleoplasmic residency aligns with a broader soluble intracellular distribution that enables dynamic exchange with cytoplasmic and organellar pathways.\n\nIntegrating these lines, I infer a mechanism in which the P40 nucleoprotein scaffold nucleates higher-order assemblies that couple nuclear RNP formation with cytoplasmic and organellar energy pathways. By recruiting host transcriptional and RNA-processing factors and viral partners, it stabilizes ribonucleoprotein complexes that indirectly regulate transcription and RNA fate, while tuning pathways that ultimately drive ATP synthesis via proton motive force.\n\nThis mechanism predicts interaction partners. The nucleoprotein fold favors associations with viral structural and regulatory proteins and with host nuclear factors. Likely partners include viral ribonucleoprotein components and regulatory proteins that coordinate assembly and shutoff of gene expression pathways; in the host, nucleoplasmic RNA-binding and transcriptional regulators are prime candidates. Together, these interactions explain how a non-enzymatic nucleoprotein scaffold exerts broad control over transcriptional and energy-coupled processes.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-P0CF75.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/P0CF75"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/P0CF75/entry","atlas":"/p/P0CF75"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}