{"uniprot":"P0DJH9","gene":"RD3L","name":"Protein RD3-like","organism":"Homo sapiens (Human)","status":"dark","length":198,"sequence":"MPLFGWMKWPKNDSYKPTHYPGSDIVTKTLLRELKWHLKERERLIQEIENEQKVKKTGVDYNWLRNYQNPHTTIPVTEQRQLEVLCSQVQPCQTGTILSRFREVLAENDVLPWEIVYIFKQVLKDFLSSSDRGSEQEDLEDSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNLPYYHPSS","function_summary":"A soluble cytoplasmic adaptor that organizes membrane-trafficking assemblies. It uses multivalent protein binding to stabilize COPII coat formation at endoplasmic reticulum exit sites, promotes vesicle budding, and guides targeting and fusion events at the Golgi. By scaffolding transport and membrane-organizing complexes, it supports intracellular vesicle flow and Golgi integrity. Its cytosolic and centrosomal residence suggests coupling of vesicle supply to microtubule-organizing functions, indirectly tuning transcriptional programs through trafficking-dependent signaling.","plain_language":"RD3L has barely been studied. The model's best guess: A soluble cytoplasmic adaptor that organizes membrane-trafficking assemblies. It uses multivalent protein binding to stabilize COPII coat formation at endoplasmic reticulum exit sites, promotes vesicle budding, and guides targeting and fusion events at the Golgi.","uniprot_summary":"May be involved in intracellular vesicle trafficking.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0048199","label":"vesicle targeting, to, from or within Golgi"},{"id":"GO:0006888","label":"endoplasmic reticulum to Golgi vesicle-mediated transport"},{"id":"GO:0061024","label":"membrane organization"},{"id":"GO:0065003","label":"protein-containing complex assembly"},{"id":"GO:0090114","label":"COPII-coated vesicle budding"},{"id":"GO:0006357","label":"regulation of transcription by RNA polymerase II"},{"id":"GO:0045944","label":"positive regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005813","label":"centrosome"}]},"interpro":[{"id":"IPR028092","name":"Retinal degeneration protein 3","type":"family","start":1,"end":198}],"reasoning":"I begin with the InterPro architecture: IPR028092 (Retinal degeneration protein 3 family) spans residues 1–198 and covers the entire polypeptide. A single full-length family signature without embedded catalytic domains indicates a soluble, non-enzymatic scaffold/adaptor. Such adaptors typically present extended, low-complexity or coiled-coil–like surfaces that mediate multivalent contacts rather than chemistry, which causally supports a primary molecular function of protein binding (GO:0005515).\n\nA full-length RD3-family scaffold is well-suited to coordinate membrane-trafficking modules. By stabilizing and positioning coat and tethering assemblies, this architecture drives vesicle formation and targeting. This directly explains roles in vesicle targeting to/from within the Golgi (GO:0048199) and in COPII-coated vesicle budding (GO:0090114): the adaptor can nucleate and stabilize COPII assembly at ER exit sites and later guide vesicle delivery and fusion with the Golgi. The same multivalent binding surface can organize larger supramolecular assemblies, accounting for protein-containing complex assembly (GO:0065003). Because vesicle flux and Golgi integrity feed forward into broader organelle biogenesis and signaling, the scaffold’s activity promotes membrane organization (GO:0061024). Its coupling to signaling pathways and transcriptional programs downstream of membrane traffic provides a mechanistic route to positive regulation of transcription by RNA polymerase II (GO:0045944), for example by trafficking receptors or secretory factors that modulate transcriptional co-regulators.\n\nCellular localization follows from this soluble adaptor role and its trafficking-centric mechanism. The absence of transmembrane segments and the family’s soluble nature place the protein in the cytosol (GO:0005829), where it can sample and assemble membrane-trafficking machinery. Its presence at the centrosome (GO:0005813) is consistent with a trafficking adaptor that also organizes microtubule- and vesicle-dependent pathways converging at the microtubule-organizing center. This cytosolic/centrosomal distribution dovetails with a broader cytoplasmic residency and transient association with Golgi-facing transport routes.\n\nMechanistically, I hypothesize that the RD3-family scaffold binds and stabilizes COPII components at ER exit sites to initiate budding, then escorts cargo-bearing carriers toward the Golgi where it helps target vesicles and assemble tethering/fusion complexes. At the centrosome, it likely coordinates vesicle supply with microtubule-based transport. Through these assemblies, it indirectly tunes transcription by controlling the delivery of signaling cargos that impinge on RNA polymerase II pathways. Likely interaction partners include COPII coat subunits (SEC23/SEC24/SEC13/SEC31), ER–Golgi tethers and SNARE machinery, and centrosomal scaffolds that couple vesicle traffic to cytoskeletal organization.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-P0DJH9.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/P0DJH9"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/P0DJH9/entry","atlas":"/p/P0DJH9"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}