{"uniprot":"P0DP03","gene":"IGHV3-30-5","name":"Immunoglobulin heavy variable 3-30-5","organism":"Homo sapiens (Human)","status":"dark","length":117,"sequence":"MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK","function_summary":"A human immunoglobulin heavy-chain variable module that forms the antigen-recognition core of antibodies. Its beta-sandwich fold and variable-type domain generate hypervariable loops that confer high-affinity binding to diverse targets, initiating the B-cell receptor pathway and driving humoral immunity. It operates at the cell surface as part of the membrane-bound receptor and is subsequently secreted into the extracellular space. By partnering with light chains and assembling into higher-order complexes, it determines antigen specificity and triggers downstream antimicrobial immune responses.","plain_language":"IGHV3-30-5 has barely been studied. The model's best guess: A human immunoglobulin heavy-chain variable module that forms the antigen-recognition core of antibodies. Its beta-sandwich fold and variable-type domain generate hypervariable loops that confer high-affinity binding to diverse targets, initiating the B-cell receptor pathway and driving humoral immunity.","uniprot_summary":"V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B-lymphocytes.","go_terms":{"molecular_function":[{"id":"GO:0042802","label":"identical protein binding"}],"biological_process":[{"id":"GO:0061844","label":"antimicrobial humoral immune response mediated by antimicrobial peptide"}],"cellular_component":[{"id":"GO:0005615","label":"extracellular space"},{"id":"GO:0005886","label":"plasma membrane"}]},"interpro":[{"id":"IPR013783","name":"Immunoglobulin-like fold","type":"homologous_superfamily","start":17,"end":117},{"id":"IPR036179","name":"Immunoglobulin-like domain superfamily","type":"homologous_superfamily","start":20,"end":117},{"id":"IPR007110","name":"Immunoglobulin-like domain","type":"domain","start":31,"end":117},{"id":"IPR013106","name":"Immunoglobulin V-set domain","type":"domain","start":31,"end":117},{"id":"IPR050199","name":"Immunoglobulin Heavy Variable","type":"family","start":10,"end":117}],"reasoning":"I begin with the InterPro architecture. The polypeptide core from residues 17–117 is saturated with immunoglobulin signatures: IPR013783 (Immunoglobulin-like fold, residues 17–117) and IPR036179 (Immunoglobulin-like domain superfamily, residues 20–117) define a beta-sandwich scaffold typical of Ig domains. Within this scaffold, IPR007110 (Immunoglobulin-like domain, residues 31–117) and IPR013106 (Immunoglobulin V-set domain, residues 31–117) specify a V-set immunoglobulin variable-type domain that forms the antigen-recognition surface. The family-level IPR050199 (Immunoglobulin Heavy Variable, residues 10–117) anchors the identity as a heavy-chain variable module. The ordered layout—an Ig-like fold and V-set domain occupying nearly the entire sequence—creates a rigid beta-sandwich that presents hypervariable loops for high-affinity binding. This architecture causes selective ligand recognition rather than catalysis.\n\nFrom this domain logic, the molecular function resolves as binding-driven recognition. The V-set domain generates complementarity-determining regions that mediate high-specificity interactions; such Ig modules frequently self-associate or form homotypic contacts during assembly and secretion, supporting GO:0042802 identical protein binding as a plausible binding mode that stabilizes variable-domain clusters and transiently promotes membrane assembly.\n\nThis binding-driven recognition directly feeds the humoral immune pathway. By specifying antigen affinity and enabling assembly of membrane-bound and secreted immunoglobulin complexes, the variable heavy domain initiates and amplifies antibody-mediated defense, aligning with GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide. Although the immunoglobulin effector arm classically neutralizes targets via opsonization and neutralization, the same axis contributes to broader antimicrobial strategies that include and interface with antimicrobial peptide systems.\n\nCellular placement follows from the dual life cycle of immunoglobulins. As part of the membrane-bound B-cell antigen receptor complex, the heavy-chain variable region resides at the cell surface, consistent with GO:0005886 plasma membrane. Upon differentiation and secretion, antibodies accumulate in the extracellular milieu, matching GO:0005615 extracellular space. The Ig-like fold and V-set domain do not encode transmembrane helices themselves; membrane association arises through other immunoglobulin components that anchor the complex until secretion.\n\nMechanistically, the variable heavy domain nucleates antigen recognition that triggers B-cell activation and antibody production. I hypothesize that it pairs with light-chain variable domains to form the complete antigen-binding site, and that homotypic contacts (identical protein binding) transiently stabilize higher-order assemblies during biosynthesis and trafficking. Likely interaction partners include light chains that complete the binding site, membrane-proximal signaling subunits that couple antigen engagement to intracellular pathways, and secretory pathway chaperones that shepherd folding and export. Together, these interactions position the variable heavy module as the specificity determinant that initiates extracellular immune effector functions.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-P0DP03.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/P0DP03"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/P0DP03/entry","atlas":"/p/P0DP03"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}