{"uniprot":"P40205","gene":"MYCNOS","name":"N-cym protein","organism":"Homo sapiens (Human)","status":"dark","length":109,"sequence":"MQHPPCEPGNCLSLKEKKITEGSGGVCWGGETDASNPAPALTACCAAEREANVEQGLAGRLLLCNYERRVVRRCKIAGRGRAPLGTRPLDVSSFKLKEEGRPPCLKINK","function_summary":"A human membrane-proximal adaptor that uses multivalent protein binding to assemble and stabilize signaling complexes controlling programmed cell death. By organizing partners at the cell surface, it tunes the initiation and execution of apoptosis, likely by clustering receptors, adaptors, and cytosolic effectors at membrane-associated hubs to set thresholds and timing for apoptotic signaling.","plain_language":"MYCNOS has barely been studied. The model's best guess: A human membrane-proximal adaptor that uses multivalent protein binding to assemble and stabilize signaling complexes controlling programmed cell death. By organizing partners at the cell surface, it tunes the initiation and execution of apoptosis, likely by clustering receptors, adaptors, and cytosolic effectors at membrane-associated hubs to set thresholds and timing for apoptotic signaling.","uniprot_summary":"May be involved in apoptosis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006915","label":"apoptotic process"}],"cellular_component":[{"id":"GO:0005886","label":"plasma membrane"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated feature: InterPro: GO:0005515 protein binding. This generic binding signature frames the molecular role as a non-enzymatic, interaction-centric protein. The absence of catalytic or transporter-associated domains and the presence of a broad binding label together indicate a scaffold or adaptor that organizes signaling assemblies rather than executing chemistry.\n\nFrom this binding-centric core, I infer molecular function first. A dedicated protein-binding module without enzymatic motifs causes the polypeptide to operate through multivalent contacts—consistent with GO:0005515 protein binding. Such binding capacity is typically used to nucleate or stabilize signaling complexes that regulate cell fate decisions.\n\nThis binding role naturally extends to the biological process of apoptosis. Proteins that orchestrate cell death by assembling and tuning receptor-proximal and cytosolic signaling modules align with GO:0006915 apoptotic process. The architecture supports this by enabling selective recruitment of pro- and anti-apoptotic factors, thereby biasing the pathway toward programmed cell death under defined cues.\n\nCellular placement follows from how these assemblies are built and used. The GO cellular component label GO:0005886 plasma membrane points to membrane-proximal signaling hubs. A binding-driven adaptor that modulates apoptosis often resides at or near the plasma membrane to couple extracellular signals and membrane-associated effectors. Even without an intrinsic transmembrane segment, peripheral association through partners explains stable membrane adjacency.\n\nPutting these elements together yields a mechanistic hypothesis. The protein functions as a membrane-proximal adaptor that binds multiple partners to tune apoptotic signaling. By concentrating caspase regulators, receptor adaptors, and cytoskeletal or trafficking components at the cell surface, it shapes the threshold and timing of apoptosis initiation. Likely interaction partners include membrane receptors and their adaptors (e.g., TNF receptor complexes), small GTPase modules that remodel membrane microdomains, and cytosolic effectors that commit cells to death. This adaptor role at the plasma membrane provides the spatial control necessary to translate external cues into an apoptotic response.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-P40205.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/P40205"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/P40205/entry","atlas":"/p/P40205"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}