{"uniprot":"P55808","gene":"XG","name":"Glycoprotein Xg","organism":"Homo sapiens (Human)","status":"dark","length":180,"sequence":"MESWWGLPCLAFLCFLMHARGQRDFDLADALDDPEPTKKPNSDIYPKPKPPYYPQPENPDSGGNIYPRPKPRPQPQPGNSGNSGGYFNDVDRDDGRYPPRPRPRPPAGGGGGGYSSYGNSDNTHGGDHHSTYGNPEGNMVAKIVSPIVSVVVVTLLGAAASYFKLNNRRNCFRTHEPENV","function_summary":"A GPI-anchored cell-surface protein that presents an extracellular ectodomain optimized for multivalent binding and clustering at the plasma membrane. By organizing adhesive and signaling assemblies in membrane microdomains, it modulates lineage decisions in bone-forming cells—enhancing osteoblast proliferation and differentiation and driving mineral deposition—while also influencing hematopoietic and lymphocyte adhesion. Its secretory trafficking through endoplasmic reticulum and Golgi targets it to the cell surface, where raft-associated partners translate extracellular binding into intracellular signaling outputs.","plain_language":"XG has barely been studied. The model's best guess: A GPI-anchored cell-surface protein that presents an extracellular ectodomain optimized for multivalent binding and clustering at the plasma membrane. By organizing adhesive and signaling assemblies in membrane microdomains, it modulates lineage decisions in bone-forming cells—enhancing osteoblast proliferation and differentiation and driving mineral deposition—while also influencing hematopoietic and lymphocyte adhesion.","uniprot_summary":"May be involved in hematopoiesis and lymphocyte adhesion processes. May play a role in osteogenesis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0033688","label":"positive regulation of osteoblast proliferation"},{"id":"GO:0030501","label":"positive regulation of bone mineralization"},{"id":"GO:0045669","label":"positive regulation of osteoblast differentiation"}],"cellular_component":[{"id":"GO:0005886","label":"plasma membrane"}]},"interpro":[{"id":"IPR022078","name":"CD99 antigen-like protein 2","type":"family","start":1,"end":176}],"reasoning":"I begin with the InterPro architecture: IPR022078 (CD99 antigen-like protein 2 family) spans residues 1–176, covering essentially the entire polypeptide. This family signature denotes a compact, glycosylphosphatidylinositol (GPI)-anchored cell-surface module that lacks cytosolic domains and instead presents an extracellular ectodomain tethered to the outer leaflet of the plasma membrane. Such an architecture enforces a mechanism based on avidity-driven clustering and extracellular protein–protein interactions rather than intracellular catalysis. The absence of enzymatic cores and the presence of a full-length family profile that matches a single-pass secretory itinerary strongly argue that this protein functions as a membrane-tethered adhesion/signaling hub. This structural logic directly supports GO:0005515 protein binding as the primary molecular function: the ectodomain mediates multivalent binding and oligomerization at the cell surface.\n\nFrom this binding-centric mechanism, I infer the biological roles. A GPI-anchored adhesion/signaling module at the cell surface can modulate lineage decisions by controlling cell–cell and cell–matrix contacts and by coupling to raft-associated kinases and integrin pathways. In osteogenic contexts, such surface hubs bias signaling thresholds that drive lineage commitment and maturation. This causal chain—extracellular binding leading to altered signaling and adhesion—aligns with processes formalized as GO:0033688 positive regulation of osteoblast proliferation, GO:0030501 positive regulation of bone mineralization, and GO:0045669 positive regulation of osteoblast differentiation. The same surface-localized mechanism can also explain roles in hematopoiesis and lymphocyte adhesion: raft-localized GPI-anchored proteins frequently tune immune cell adhesion and signaling, consistent with a broader adhesion/signaling role.\n\nCellular location follows directly from the architecture and trafficking route. A GPI-anchored ectodomain is delivered through the secretory pathway and displayed at the plasma membrane, matching GO:0005886 plasma membrane. The experimentally observed itinerary—synaptosome enrichment and transit through endoplasmic reticulum and Golgi apparatus—is expected for secretory cargos and supports a cell-surface destination. The membrane tether and raft association concentrate the protein in specific membrane microdomains where it can scaffold signaling assemblies.\n\nMechanistically, I hypothesize that the ectodomain forms cis clusters that nucleate extracellular adhesion complexes and transduce signals via raft-resident partners. By stabilizing adhesive contacts and tuning receptor proximal pathways, the protein elevates osteoblast proliferation and differentiation and promotes matrix deposition and mineralization. Likely interaction partners include integrins and their adaptors, tetraspanins and metalloproteinases that co-assemble at adhesive sites, as well as Src-family kinases and PI3K effectors that interpret raft signals. Together, these assemblies provide a coherent route from extracellular binding to osteogenic transcriptional programs and bone matrix maturation.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-P55808.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/P55808"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/P55808/entry","atlas":"/p/P55808"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}