{"uniprot":"P59780","gene":"AP3S2","name":"AP-3 complex subunit sigma-2","organism":"Homo sapiens (Human)","status":"dark","length":193,"sequence":"MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV","function_summary":"A cytoplasmic adaptor-chain subunit of a vesicle-coat complex that organizes intracellular membrane trafficking. By forming a longin-like scaffold, it stabilizes an adaptor assembly that recognizes cargo sorting signals and promotes vesicle formation along endosomal and Golgi-associated routes. This assembly-driven binding role supports intracellular transport and enhances protein exit from the endoplasmic reticulum by coordinating cargo flow between ER-derived pathways and endomembrane compartments.","plain_language":"AP3S2 has barely been studied. The model's best guess: A cytoplasmic adaptor-chain subunit of a vesicle-coat complex that organizes intracellular membrane trafficking. By forming a longin-like scaffold, it stabilizes an adaptor assembly that recognizes cargo sorting signals and promotes vesicle formation along endosomal and Golgi-associated routes.","uniprot_summary":"Subunit of clathrin-associated adaptor protein complex 3 that plays a role in protein transport via clathrin-coated vesicles.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006886","label":"intracellular protein transport"},{"id":"GO:0070863","label":"positive regulation of protein exit from endoplasmic reticulum"}],"cellular_component":[{"id":"GO:0030119","label":"AP-type membrane coat adaptor complex"},{"id":"GO:0043231","label":"intracellular membrane-bounded organelle"}]},"interpro":[{"id":"IPR011012","name":"Longin-like domain superfamily","type":"homologous_superfamily","start":1,"end":147},{"id":"IPR022775","name":"AP complex, mu/sigma subunit","type":"domain","start":1,"end":147},{"id":"IPR027155","name":"AP-3 complex subunit sigma","type":"family","start":1,"end":146},{"id":"IPR016635","name":"Adaptor protein complex, sigma subunit","type":"family","start":2,"end":149},{"id":"IPR000804","name":"Clathrin adaptor complex, small chain","type":"conserved_site","start":63,"end":73}],"reasoning":"I begin with the InterPro architecture. The polypeptide is entirely covered by IPR011012 (Longin-like domain superfamily, residues 1–147), a β-sandwich longin-like fold characteristic of small adaptor chains that assemble clathrin adaptor complexes and bind short linear sorting signals on cargo. This fold is reinforced by IPR022775 (AP complex, mu/sigma subunit domain, residues 1–147), specifying that the longin-like core is tailored for adaptor-complex small subunits that stabilize cargo/adaptor assemblies rather than catalysis. Two family-level signatures, IPR027155 (AP-3 complex subunit sigma, residues 1–146) and IPR016635 (Adaptor protein complex, sigma subunit, residues 2–149), pinpoint the identity as the σ subunit of the AP-3 adaptor complex. A conserved functional hotspot is marked by IPR000804 (Clathrin adaptor complex, small chain, conserved site, residues 63–73), which typically contributes to cargo/adaptor engagement and complex integrity. The ordered architecture—an N-to-C continuous longin-like σ-chain core with a conserved site—causes a non-enzymatic, multivalent binding role that nucleates and stabilizes vesicle-coat assemblies.\n\nFrom this architecture, the molecular function resolves as protein binding (GO:0005515). The σ-chain’s longin-like scaffold and conserved site create a high-affinity platform for assembling AP-3 and for docking to partner subunits and cargo-sorting motifs; this binding-centric design explains the absence of catalytic domains and the presence of multiple adaptor-specific signatures.\n\nThis binding role drives intracellular trafficking processes. By stabilizing AP-3 assemblies that sort membrane proteins bearing tyrosine-based and related sorting signals, the σ subunit promotes intracellular protein transport (GO:0006886). AP-3 operates downstream of ER export routes and interfaces with ER-to-Golgi and endosome–lysosome pathways; thus, its assembly activity positively regulates protein exit from the endoplasmic reticulum (GO:0070863), coordinating cargo flow from ER-derived pathways into endosomal/Golgi itineraries.\n\nCellular localization follows from the coat-adaptor identity and binding mechanism. The σ subunit resides within the AP-type membrane coat adaptor complex (GO:0030119), assembling on cytoplasmic faces of endomembranes. Its soluble, peripheral nature and recruitment to vesicle coats place it broadly in the cytoplasm and across intracellular membrane-bounded organelles, consistent with a cytoplasmic adaptor that transiently associates with endosomes, lysosomes, and Golgi-derived carriers.\n\nMechanistically, the σ subunit forms the small-chain corner of the AP-3 heterotetramer, stabilizing the complex that recognizes cargo sorting signals and nucleates clathrin-coated and related vesicles. I hypothesize that it binds fellow AP-3 subunits (μ3, β3, δ) to form the core adaptor, engages cargo cytosolic tails (e.g., lysosomal membrane proteins), and transiently recruits accessory factors that couple AP-3 assemblies to endosomal–lysosomal routes. This assembly-centric mechanism explains how the σ subunit orchestrates cargo selection and vesicle budding within the endomembrane system.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-P59780.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/P59780"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/P59780/entry","atlas":"/p/P59780"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}