{"uniprot":"Q0VDD5","gene":"MIR22HG","name":"Putative uncharacterized protein encoded by MIR22HG","organism":"Homo sapiens (Human)","status":"dark","length":57,"sequence":"MGWEGPNSRVDDTFWASWRAFAQIGPARSGFRLETLAGLRSRRLKQPKAFCLRDVAP","function_summary":"A human regulatory scaffold that modulates smooth muscle contraction by assembling protein complexes rather than catalyzing reactions. Its binding-driven architecture positions it as an adaptor that couples mitochondrial energy and calcium-buffering functions to contractile machinery, stabilizing the local ATP and Ca2+ microdomains that drive contraction. By organizing partner proteins at the mitochondrial interface, it fine-tunes the efficiency and timing of the contractile cycle.","plain_language":"MIR22HG has barely been studied. The model's best guess: A human regulatory scaffold that modulates smooth muscle contraction by assembling protein complexes rather than catalyzing reactions. Its binding-driven architecture positions it as an adaptor that couples mitochondrial energy and calcium-buffering functions to contractile machinery, stabilizing the local ATP and Ca2+ microdomains that drive contraction.","uniprot_summary":"May play a role in smooth muscle regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006939","label":"smooth muscle contraction"}],"cellular_component":[{"id":"GO:0005739","label":"mitochondrion"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The absence of catalytic InterPro signatures and the presence of a generic protein-binding label indicate a non-enzymatic scaffold/adaptor whose primary role is to organize other proteins. This binding-centric architecture typically arises in regulatory complexes that tune cytoskeletal or membrane-associated assemblies.\n\nFrom this binding-driven core, I infer molecular function first. A solitary, non-catalytic binding module without transmembrane or enzymatic motifs causes the protein to act through multivalent interactions rather than chemistry. That architecture directly supports GO:0005515 protein binding as the operative molecular function, positioning the protein as a connector that stabilizes or targets other factors.\n\nThis binding role links causally to smooth muscle contraction (GO:0006939). Smooth muscle relies on calcium-regulated assemblies that couple membrane excitability to actomyosin activation and intracellular Ca2+ handling. A binding scaffold can regulate this by tethering calcium-handling proteins and cytoskeletal regulators, thereby tuning contraction amplitude and timing. The stated role in smooth muscle regulation follows naturally from a non-enzymatic organizer that modulates contractile machinery.\n\nCellular placement follows next. The GO cellular component label mitochondrion (GO:0005739) anchors the inference. Mitochondria in contractile tissues physically and functionally interface with the contractile apparatus and Ca2+ pathways. A mitochondrial residence for a binding scaffold creates a mechanism: by residing on or near mitochondria, the protein can buffer local ATP supply and buffer Ca2+ flux, thereby shaping the energy and calcium microdomains that drive contraction. This mitochondrial association explains how a non-enzymatic binder exerts system-level control over smooth muscle contractility.\n\nPutting these elements together yields a mechanistic hypothesis. The protein operates as a mitochondrial-associated adaptor that organizes protein complexes controlling contraction. By binding partners rather than substrates, it modulates smooth muscle contraction through spatial coordination: it likely couples mitochondrial ATP production and Ca2+ uptake/release to membrane-proximal contractile assemblies. This coupling would stabilize calcium signaling fidelity and energy availability precisely where contraction is initiated.\n\nFrom this model, I hypothesize interaction partners that fit the mechanism. At the mitochondrial surface, it may engage TOM complex components (e.g., TOMM20/TOMM40) and voltage-dependent anion channels (VDAC1) to position itself at the organelle interface. In the contractile apparatus, it could associate with smooth muscle myosin light chain and caldesmon/caldesmin complexes that regulate actomyosin. To integrate Ca2+ handling, it may transiently bind mitochondrial Ca2+ uptake machinery and local Ca2+-signaling hubs. These partnerships collectively explain how a binding-focused, mitochondria-localized scaffold regulates smooth muscle contraction.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q0VDD5.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q0VDD5"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q0VDD5/entry","atlas":"/p/Q0VDD5"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}