{"uniprot":"Q107X0","gene":"KLKP1","name":"Putative protein KRIP1","organism":"Homo sapiens (Human)","status":"dark","length":134,"sequence":"MSPVHRSRTSQTQEAHKPTSTLSFISPPQPPRQDPKSPHILCSQPNACSRQSHVSYPNPWGLPCSQSKVSPPGTATNPNPKEWSRISGPPVSLDPQPWSSAPFKPTAQLPLLAQSLGPPAKPALPDPALPLQML","function_summary":"A soluble nuclear scaffold that likely participates in immune and reproductive pathways by assembling regulatory protein complexes in the nucleoplasm. By mediating selective protein–protein interactions rather than catalysis, it organizes transcriptional and chromatin-associated assemblies that tune innate immune gene expression and related reproductive programs, consistent with its residence in the nucleus and its inferred adaptor architecture.","plain_language":"KLKP1 has barely been studied. The model's best guess: A soluble nuclear scaffold that likely participates in immune and reproductive pathways by assembling regulatory protein complexes in the nucleoplasm. By mediating selective protein–protein interactions rather than catalysis, it organizes transcriptional and chromatin-associated assemblies that tune innate immune gene expression and related reproductive programs, consistent with its residence in the nucleus and its inferred adaptor architecture.","uniprot_summary":"May be involved in immune and reproductive processes.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0045087","label":"innate immune response"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The presence of only a generic protein-binding signature and the absence of catalytic or transmembrane domains indicates a soluble adaptor or scaffold rather than an enzyme or transporter. Such architectures typically mediate selective macromolecular interactions through low-complexity or modular binding surfaces, which causally supports a primary molecular function of protein binding.\n\nFrom this binding-centric core, I infer the biological role by considering how a non-enzymatic scaffold can influence cellular programs. The explicit association with immune pathways is signaled by the process label GO:0045087 innate immune response. A nuclear scaffold can regulate innate immunity by controlling transcriptional and chromatin-associated assemblies that set thresholds for inflammatory gene expression. The provided functional description that it may be involved in immune and reproductive processes aligns with a regulatory role that tunes stimulus-responsive transcription rather than executing effector chemistry.\n\nCellular localization is resolved by the compartment label GO:0005654 nucleoplasm and the stated nuclear residence. A nucleoplasmic scaffold is well positioned to assemble transcription factors, co-regulators, and chromatin remodelers that govern rapid innate immune gene programs and, by extension, reproductive pathways that share transcriptional control modules. The lack of membrane features and the explicit nuclear localization together argue for a soluble nuclear protein that organizes regulatory complexes.\n\nMechanistically, a nuclear adaptor that binds partners and biases innate immune outputs likely operates by nucleating transient assemblies that modulate accessibility and timing of defense genes. I hypothesize that it recruits transcriptional regulators and chromatin modifiers in the nucleoplasm to calibrate interferon and cytokine-responsive circuits. In reproductive contexts, the same scaffolding logic could coordinate gene networks for gametogenesis or follicular support by assembling pathway-specific transcriptional hubs.\n\nThis yields a coherent model: a nucleoplasmic, non-enzymatic binder that shapes innate immune response and reproductive pathways through assembly of nuclear regulatory complexes. It likely engages transcription factors and co-regulators, chromatin remodelers, and nuclear transport machinery to execute this role.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q107X0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q107X0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q107X0/entry","atlas":"/p/Q107X0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}