{"uniprot":"Q14236","gene":"DIAPH2-AS1","name":"Early lymphoid activation gene protein","organism":"Homo sapiens (Human)","status":"dark","length":149,"sequence":"MNLYLHPKLWPQLAGTKTLHVADAQRVRKITVHDGIWDAELPRAKRNHSYHLRYHGSSYSRCFLERYRCKTIGVFRRSNQPDCLETRSEKAKNRDGVVQEKSVRTLFSECVNQCDIRRRPTRFLRMFYHQKHFQLGLKGTETEKNERRL","function_summary":"A soluble human regulatory scaffold that enhances transcription by assembling and stabilizing transcriptional co-regulator complexes and recruiting chromatin-remodeling activities. It operates primarily in the nucleoplasm, where it promotes an open chromatin state and elevated transcriptional output, while also assembling with partners in the cytosol before nuclear engagement. Its mechanism centers on multivalent protein binding that organizes activator and chromatin-modifying modules to positively regulate gene expression.","plain_language":"DIAPH2-AS1 has barely been studied. The model's best guess: A soluble human regulatory scaffold that enhances transcription by assembling and stabilizing transcriptional co-regulator complexes and recruiting chromatin-remodeling activities. It operates primarily in the nucleoplasm, where it promotes an open chromatin state and elevated transcriptional output, while also assembling with partners in the cytosol before nuclear engagement.","uniprot_summary":"Involved in transcriptional regulation. Involved in chromatin remodeling (By similarity).","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0010628","label":"positive regulation of gene expression"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: InterPro domain 1 (noted as the sole InterPro entry) that occupies the core of the polypeptide. The absence of catalytic signatures and the presence of a solitary, broad interaction-prone domain point to a non-enzymatic scaffold whose primary role is macromolecular assembly. Such architectures typically mediate multivalent contacts with transcriptional regulators and chromatin-associated factors, which causally supports a binding-centric molecular function rather than enzymatic chemistry.\n\nFrom this architecture, the most direct molecular function is protein binding (GO:0005515). A scaffold-like core without enzymatic motifs achieves function by organizing other proteins—particularly transcriptional co-regulators and chromatin remodelers—into higher-order assemblies. This binding-driven mechanism aligns with a role in transcriptional control rather than direct DNA or RNA catalysis.\n\nThis binding-centric design naturally feeds into positive regulation of gene expression (GO:0010628). By stabilizing transcriptional activator complexes and enhancing the efficiency of transcriptional initiation and elongation, the protein increases transcriptional output of target loci. The explicit linkage to chromatin remodeling provides the causal bridge: assembling or recruiting nucleosome remodeling activities loosens local chromatin and elevates promoter accessibility, thereby positively regulating transcription.\n\nCellular localization follows from this regulatory logic. Transcriptional co-regulators and chromatin remodelers operate predominantly in the nucleoplasm (GO:0005654), where promoter and enhancer assemblies form. At the same time, many transcriptional scaffolds shuttle through the cytosol (GO:0005829), where they assemble pre-nuclear complexes, undergo post-translational modification, and traffic to the nucleus. The dual cytosol–nucleoplasm distribution therefore emerges directly from a soluble, non-membranous scaffold that cycles between assembly sites and its nuclear action zone.\n\nMechanistically, I hypothesize that the protein functions as a chromatin-tethered co-regulatory hub. Its single interaction-prone domain nucleates complexes with transcription factors and ATP-dependent chromatin remodelers, recruiting histone-modifying enzymes and mediator-like assemblies to potentiate transcription. Likely partners include SWI/SNF-family remodelers, histone acetyltransferase modules, and general coactivators; transient cytosolic assembly with importins would facilitate nucleocytoplasmic shuttling. Through these assemblies, the protein enhances transcriptional output by stabilizing activator complexes and promoting chromatin states permissive to RNA polymerase II engagement.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q14236.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q14236"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q14236/entry","atlas":"/p/Q14236"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}