{"uniprot":"Q14602","gene":"ID2B","name":"Putative DNA-binding protein inhibitor ID-2B","organism":"Homo sapiens (Human)","status":"dark","length":36,"sequence":"MKAFSPVRSIRKNSLLDHRLGISQSKTPVDDLMSLL","function_summary":"A human adaptor protein that uses multivalent binding to assemble and regulate protein complexes controlling gene expression. By scaffolding transcriptional regulators and RNA polymerase II machinery, it modulates transcriptional output and likely couples this regulation to mitochondrial status. Its mitochondrial association positions it to sense or relay organellar cues that fine-tune nuclear transcription through a binding-driven regulatory mechanism.","plain_language":"ID2B has barely been studied. The model's best guess: A human adaptor protein that uses multivalent binding to assemble and regulate protein complexes controlling gene expression. By scaffolding transcriptional regulators and RNA polymerase II machinery, it modulates transcriptional output and likely couples this regulation to mitochondrial status.","uniprot_summary":"May be involved in transcriptional regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006357","label":"regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005739","label":"mitochondrion"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The presence of only a generic protein-binding signature and the absence of catalytic or nucleic-acid–binding domains indicates a non-enzymatic scaffold/adaptor that exerts function through selective protein–protein interactions. Such architectures typically mediate assembly and regulation of larger complexes rather than performing chemistry directly.\n\nFrom this binding-centric core, I infer molecular function first. A dedicated protein-binding module without enzymatic motifs causes the polypeptide to act as a hub that stabilizes or modulates multiprotein assemblies. This directly supports GO:0005515 protein binding as the operative molecular function. Binding-driven regulation is a common mechanism for transcriptional control.\n\nNext, I connect binding to process. The biological role centers on transcriptional modulation. A binding scaffold can regulate gene expression by recruiting or positioning transcriptional regulators and RNA polymerase II machinery. This causal chain—binding scaffold → assembly of regulatory complexes → modulation of transcription—maps to GO:0006357 regulation of transcription by RNA polymerase II. The description of transcriptional modulation and the note that it may be involved in transcriptional regulation are mechanistically explained by this adaptor architecture.\n\nCellular location is resolved by two converging lines. The formal cellular component label GO:0005739 mitochondrion indicates a mitochondrial association, and the broader subcellular annotation to the mitochondrion implies a primary organellar residence or dynamic shuttling. A transcriptional regulator that resides at or communicates with mitochondria can couple nuclear-encoded transcription to mitochondrial status. Binding scaffolds frequently localize to mitochondria to sense metabolic cues and relay them to nuclear transcriptional programs.\n\nPutting these pieces together yields a mechanistic hypothesis. A mitochondrial-associated adaptor that binds other proteins can tune transcription by RNA polymerase II through one of two, possibly concurrent, routes:  \n1) It assembles or stabilizes transcriptional regulator complexes that operate near mitochondria—such as chromatin-modifying assemblies or Mediator submodules—thereby modulating nuclear transcription in response to organellar signals.  \n2) It relays mitochondrial metabolic or stress information via transient interactions with transcription factors and co-regulators, aligning nuclear gene expression with mitochondrial function.  \n\nThis model predicts interaction partners that are consistent with transcriptional regulation and mitochondrial coupling: nuclear transcription machinery (e.g., RNA polymerase II and Mediator), chromatin remodelers and histone-modifying enzymes, and mitochondrial surface complexes that nucleate signaling hubs. The absence of catalytic domains and the presence of a binding-centric architecture causally anchor the role as a regulatory scaffold that integrates mitochondrial cues into transcriptional outputs.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q14602.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q14602"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q14602/entry","atlas":"/p/Q14602"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}