{"uniprot":"Q15053","gene":"KIAA0040","name":"Uncharacterized protein KIAA0040","organism":"Homo sapiens (Human)","status":"dark","length":99,"sequence":"MERISAFFSSIWDTILTKHQEGIYNTICLGVLLGLPLLVIITLLFICCHCCWSPPGKRGQQPEKNKKKKKKKKKKDEEDLWISAQPKLLQMEKRPSLPV","function_summary":"A human single-pass membrane adaptor that promotes NF-kappaB pathway activation by assembling signaling complexes at the cell surface and along the secretory pathway. It operates primarily through multivalent protein binding rather than catalysis, using a conserved binding surface to recruit and stabilize upstream modules that enhance I-kappaB kinase signaling. The protein resides at the plasma membrane and traffics through the endoplasmic reticulum during biogenesis, positioning it to potentiate pathway assembly and signaling flux.","plain_language":"KIAA0040 has barely been studied. The model's best guess: A human single-pass membrane adaptor that promotes NF-kappaB pathway activation by assembling signaling complexes at the cell surface and along the secretory pathway. It operates primarily through multivalent protein binding rather than catalysis, using a conserved binding surface to recruit and stabilize upstream modules that enhance I-kappaB kinase signaling.","uniprot_summary":"May be involved in activation of NF-kappaB.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0043123","label":"positive regulation of I-kappaB kinase/NF-kappaB signaling"}],"cellular_component":[{"id":"GO:0005783","label":"endoplasmic reticulum"},{"id":"GO:0005886","label":"plasma membrane"}]},"interpro":[{"id":"IPR039964","name":"Uncharacterized protein KIAA0040-like","type":"family","start":17,"end":99}],"reasoning":"I begin with the InterPro architecture: a single annotated region IPR039964 (Uncharacterized protein KIAA0040-like family) spanning residues 17–99. This family signature marks a conserved, largely non-enzymatic module that typically encodes a cytosol-facing binding surface rather than a catalytic core. The compact architecture—one family-defining region without recognizable catalytic motifs—argues that the polypeptide functions as a membrane-tethered adaptor that organizes other proteins. Such adaptors exert their role through multivalent contacts, which causally supports GO:0005515 protein binding as the primary molecular function.\n\nA membrane-tethered adaptor can control signaling by positioning and stabilizing pathway assemblies. The explicit biological role emerges from its capacity to enhance I-kappaB kinase/NF-kappaB signaling: by recruiting or stabilizing upstream modules, the adaptor increases IKK complex engagement and activation, which corresponds to GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB signaling. This regulatory effect is mechanistically consistent with a non-enzymatic scaffold that biases pathway flux rather than directly modifying substrates.\n\nCellular localization follows from both the adaptor role and trafficking cues. The presence of a membrane-anchored architecture and experimental evidence place the protein at the cell surface as a single-pass membrane component, aligning with GO:0005886 plasma membrane. Its biogenesis and quality control require transit through the secretory pathway, and the observed endoplasmic reticulum residence is consistent with membrane insertion and folding steps, aligning with GO:0005783 endoplasmic reticulum. Together, these compartments explain how the protein acquires and maintains membrane association while assembling signaling complexes.\n\nIntegrating these lines of evidence yields a mechanistic hypothesis: a single-pass membrane adaptor that exposes a cytosolic binding platform (encoded by the IPR039964 family region) to nucleate IKK/NF-kappaB activation modules at the plasma membrane and along ER–Golgi trafficking routes. By concentrating pathway components and stabilizing their interactions, the adaptor elevates NF-kappaB signaling output. Likely partners include the IKK complex (IKKα/CHUK, IKKβ/IKBKB, and the regulatory subunit NEMO/IKBKG), membrane-proximal adaptors that feed into NF-kappaB (e.g., TRAF2 and RIPK1), and trafficking machinery that positions the adaptor at signaling-competent membrane microdomains. This arrangement explains how a non-enzymatic, membrane-anchored scaffold can drive pathway activation through spatial organization rather than direct catalysis.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q15053.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q15053"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q15053/entry","atlas":"/p/Q15053"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}