{"uniprot":"Q15486","gene":"GUSBP1","name":"Putative inactive beta-glucuronidase-like protein SMA3","organism":"Homo sapiens (Human)","status":"dark","length":140,"sequence":"MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPASLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV","function_summary":"A secreted, matrix-associated adhesion modulator that uses a beta-sandwich scaffold to bind partners and organize extracellular–intracellular signaling pathways. By stabilizing cell–matrix assemblies and shuttling between extracellular and nucleoplasmic pools, it coordinates cues that drive skeletal and nervous system development. Its intracellular trafficking and nucleoplasmic accumulation suggest coupling of adhesion signals to transcriptional programs that refine developmental outcomes.","plain_language":"GUSBP1 has barely been studied. The model's best guess: A secreted, matrix-associated adhesion modulator that uses a beta-sandwich scaffold to bind partners and organize extracellular–intracellular signaling pathways. By stabilizing cell–matrix assemblies and shuttling between extracellular and nucleoplasmic pools, it coordinates cues that drive skeletal and nervous system development.","uniprot_summary":"Could be a component of an adhesion mechanism or a regulator of cell adhesion.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0001501","label":"skeletal system development"},{"id":"GO:0007399","label":"nervous system development"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR013783","name":"Immunoglobulin-like fold","type":"homologous_superfamily","start":7,"end":83},{"id":"IPR036156","name":"Beta-Galactosidase/glucuronidase domain superfamily","type":"homologous_superfamily","start":17,"end":79}],"reasoning":"I begin with the InterPro architecture. The N-terminal region (residues 7–83) carries IPR013783, an immunoglobulin-like fold (homologous_superfamily), and residues 17–79 fall within IPR036156, the beta-galactosidase/glucuronidase domain superfamily. This juxtaposition of an Ig-like beta-sandwich with a glycoside-hydrolase-like superfamily fold creates a compact beta-core that is well suited for avid protein–protein interactions and for ligand or matrix engagement rather than classical hydrolysis. The Ig-like fold provides a rigid scaffold for selective binding, while the beta-galactosidase/glucuronidase superfamily signature indicates an evolutionary repurposing of a hydrolase fold into a non-enzymatic adhesion module. This architecture causally supports a molecular function centered on multivalent protein binding (GO:0005515), consistent with a matricellular regulator that organizes extracellular and intracellular complexes.\n\nFrom this binding-centric core, I infer the biological roles. A secreted, matrix-associated regulator that binds partners can modulate cell adhesion and signaling pathways that govern tissue morphogenesis. Such modulation directly feeds into skeletal system development (GO:0001501), where extracellular matrix composition and cell–matrix signaling instruct osteoblast and chondrocyte behavior, and into nervous system development (GO:0007399), where adhesion and matrix cues shape neurite outgrowth and synaptogenesis. The domain scaffold that favors matrix and receptor interactions provides the mechanistic basis for these developmental influences.\n\nCellular localization follows from the same logic and the stated trafficking behavior. The presence of a secreted, matrix-binding scaffold aligns with extracellular residence and deposition in the extracellular matrix. The protein is also detected in the cytoplasm and nucleus, and specifically accumulates in the nucleoplasm (GO:0005654). This dual extracellular–intracellular distribution is coherent for matricellular regulators that shuttle between compartments: they can be secreted and re-internalized, or translocate via carrier pathways to coordinate gene expression programs downstream of adhesion signaling. Thus, I expect predominant extracellular matrix association with additional nucleoplasmic pools that tune developmental transcriptional responses.\n\nMechanistically, I hypothesize that the Ig-like fold and the repurposed glycoside-hydrolase-like core assemble a high-affinity platform that captures integrins and matrix components, stabilizing adhesion complexes and channeling signals that influence osteogenic and neurogenic pathways. In the nucleus, the same scaffold likely binds transcriptional regulators to couple extracellular cues to developmental gene networks. Likely interaction partners include integrins and heparan sulfate proteoglycans at the cell surface and matrix, and nuclear factors that interpret adhesion-derived signals. Together, these features define a secreted, matrix-associated adhesion modulator that exerts intracellular and extracellular control over skeletal and neural development, with a nucleoplasmic subpopulation fine-tuning transcriptional outputs.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q15486.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q15486"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q15486/entry","atlas":"/p/Q15486"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}