{"uniprot":"Q16609","gene":"LPAL2","name":"Putative apolipoprotein(a)-like protein 2","organism":"Homo sapiens (Human)","status":"dark","length":132,"sequence":"MEHKEVVLLLLLFLKSAPTETGPSVQECYHSNGQSYRGTYFTTVTGRTCQAWSSMTPHQHSRTPEKYPNDGLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTRCSDDEGTVFVPLTVIPVPSLEDSFIQVA","function_summary":"A secreted human extracellular adaptor built around a single kringle module that mediates high-affinity binding to lysine- and matrix-rich surfaces. By assembling and positioning soluble complexes rather than catalyzing reactions itself, it likely modulates pericellular protease pathways and matrix-associated events in the extracellular space. Its kringle scaffold concentrates protease and regulator assemblies at fibrin/fibrinogen-like niches and glycosaminoglycan-rich sites, thereby tuning where and when extracellular proteolysis proceeds.","plain_language":"LPAL2 has barely been studied. The model's best guess: A secreted human extracellular adaptor built around a single kringle module that mediates high-affinity binding to lysine- and matrix-rich surfaces. By assembling and positioning soluble complexes rather than catalyzing reactions itself, it likely modulates pericellular protease pathways and matrix-associated events in the extracellular space.","uniprot_summary":"May play a role in extracellular proteolysis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006508","label":"proteolysis"}],"cellular_component":[{"id":"GO:0005615","label":"extracellular space"}]},"interpro":[{"id":"IPR013806","name":"Kringle-like fold","type":"homologous_superfamily","start":14,"end":119},{"id":"IPR038178","name":"Kringle superfamily","type":"homologous_superfamily","start":14,"end":115},{"id":"IPR000001","name":"Kringle","type":"domain","start":26,"end":107},{"id":"IPR050759","name":"Serine proteases and regulators with kringle domains","type":"family","start":24,"end":112},{"id":"IPR018056","name":"Kringle, conserved site","type":"conserved_site","start":76,"end":88}],"reasoning":"I begin with the InterPro architecture. The N-terminal third of the protein is dominated by a kringle module: IPR013806 (Kringle-like fold, residues 14–119) and IPR038178 (Kringle superfamily, residues 14–115) define the overall β-sheet sandwich scaffold that mediates high-affinity, often lysine-dependent, ligand binding in the extracellular milieu. Within this scaffold sits a canonical kringle core, IPR000001 (Kringle domain, residues 26–107), and a hallmark lysine-binding/cystine-knot signature, IPR018056 (Kringle, conserved site, residues 76–88). The sequence is further classified by IPR050759 (Serine proteases and regulators with kringle domains, residues 24–112), which places the kringle module in the context of secreted protease systems and their regulators. The ordered layout—an N-terminal kringle fold with a central canonical kringle and conserved site—creates a compact, disulfide-stabilized binding module that typically targets fibrin/fibrinogen-like surfaces, lysine-rich motifs, and glycosaminoglycans. Notably, there is no downstream trypsin-like catalytic domain or protease signature in this architecture, indicating a non-enzymatic binding/adaptor role rather than catalysis.\n\nThis kringle-centric architecture causally supports GO:0005515 protein binding as the molecular function: kringle folds generate avid, modular binding surfaces that assemble or position extracellular partners. The absence of catalytic motifs and the presence of a single kringle domain argue that the protein acts as a soluble adaptor or decoy within protease networks rather than an enzyme.\n\nFrom this binding-centric function, I infer participation in GO:0006508 proteolysis at the systems level. Kringle-bearing proteins frequently tune pericellular proteolysis by docking proteases and their zymogens onto extracellular matrices or inhibitors, thereby shaping where and when cleavage occurs. A solitary kringle module can localize complexes to fibrin/fibrinogen-like or lysine-rich niches and modulate access to substrates, aligning with a role in extracellular proteolytic pathways.\n\nThe cellular context follows directly. Kringle modules are archetypal extracellular binding domains, and the IPR050759 family annotation points to secreted protease/regulator assemblies. This supports localization to the extracellular compartment, consistent with GO:0005615 extracellular space and the experimentally observed secreted status. A secreted, soluble adaptor with a kringle fold is expected to diffuse or tether within pericellular fluids.\n\nMechanistically, I hypothesize that this protein operates as a soluble kringle adaptor that organizes or buffers extracellular protease cascades. By presenting a high-affinity kringle binding surface, it likely captures fibrin/fibrinogen-like ligands, lysine-exposed matrices, or glycosaminoglycans to concentrate protease/regulator complexes. In doing so, it may transiently bind and position serine proteases and their inhibitors, biasing pathway flux without catalysis of its own. Likely interaction partners include fibrin/fibrinogen, plasminogen/plasmin systems, and extracellular inhibitors such as alpha-2-macroglobulin or alpha-2-macroglobulin-like assemblies; these contacts would collectively tune pericellular proteolysis and matrix remodeling in the extracellular space.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q16609.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q16609"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q16609/entry","atlas":"/p/Q16609"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}