{"uniprot":"Q2NKX9","gene":"C2orf68","name":"UPF0561 protein C2orf68","organism":"Homo sapiens (Human)","status":"dark","length":166,"sequence":"MEAGPHPRPGHCCKPGGRLDMNHGFVHHIRRNQIARDDYDKKVKQAAKEKVRRRHTPAPTRPRKPDLQVYLPRHRDVSAHPRNPDYEESGESSSSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAHTPLDPPMREALKLRIQEEIAKRQSQH","function_summary":"A soluble cytoplasmic adaptor that promotes assembly and stabilization of cytosolic ribonucleoprotein complexes to preserve mRNA integrity. By using a compact, non-enzymatic interaction surface, it organizes higher-order assemblies that bias transcripts toward stabilization rather than decay, thereby supporting orderly mRNA handling within the cytosol.","plain_language":"C2orf68 has barely been studied. The model's best guess: A soluble cytoplasmic adaptor that promotes assembly and stabilization of cytosolic ribonucleoprotein complexes to preserve mRNA integrity. By using a compact, non-enzymatic interaction surface, it organizes higher-order assemblies that bias transcripts toward stabilization rather than decay, thereby supporting orderly mRNA handling within the cytosol.","uniprot_summary":"Involved in mRNA stabilization.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0048255","label":"mRNA stabilization"},{"id":"GO:0065003","label":"protein-containing complex assembly"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"}]},"interpro":[{"id":"IPR018888","name":"Uncharacterised protein family UPF0561","type":"family","start":5,"end":166}],"reasoning":"I begin with the domain architecture: the polypeptide is almost entirely encompassed by IPR018888 (Uncharacterised protein family UPF0561, residues 5–166). A single, family-level signature spanning the full length indicates a compact, soluble fold without catalytic hallmarks or transmembrane segments. Such all-encompassing family domains typically encode adaptor or scaffold modules that mediate macromolecular assembly through surface-mediated interactions rather than enzymatic chemistry. This architecture causally supports a primary molecular role in multivalent protein association, aligning with GO:0005515 protein binding.\n\nFrom this binding-centric core, I infer function in ribonucleoprotein (RNP) assembly and stabilization. The UPF0561 family’s soluble, non-enzymatic nature suits it to nucleate or stabilize higher-order assemblies. This directly explains participation in GO:0065003 protein-containing complex assembly: a binding-driven scaffold can template the formation of cytosolic complexes. The biological context is clarified by the protein’s role in preserving mRNA integrity: a cytosolic adaptor that organizes RNP assemblies can shield transcripts from decay pathways and promote their orderly handling. This causal chain—from a binding-optimized fold to assembly of cytosolic complexes that preserve transcripts—maps to GO:0048255 mRNA stabilization.\n\nCellular localization follows from the absence of signal peptides or membrane anchors and the need to interface with cytoplasmic mRNPs and translation/decay machinery. A soluble assembly factor that stabilizes mRNA is expected to operate in the cytoplasm, specifically the aqueous phase where RNP granules and translation complexes reside. This reasoning supports GO:0005829 cytosol and is consistent with a broader cytoplasmic residency.\n\nMechanistically, I hypothesize that the UPF0561 fold presents interaction surfaces that recruit and organize cytosolic RNP components. By concentrating RNA-binding proteins and helicases into assemblies, it can bias mRNA fate toward storage or translation and away from decay. Likely partners include cytosolic mRNP organizers and translation modulators—such as poly(A)-binding and cap-binding factors, DEAD-box helicases, and stress-granule nucleators—together forming a dynamic platform that stabilizes mRNA in the cytosol. This adaptor-driven mechanism explains how a single-domain, soluble protein can exert decisive control over mRNA stabilization and cytosolic complex assembly.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q2NKX9.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q2NKX9"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q2NKX9/entry","atlas":"/p/Q2NKX9"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}