{"uniprot":"Q2VIR3","gene":"EIF2S3B","name":"Eukaryotic translation initiation factor 2 subunit 3B","organism":"Homo sapiens (Human)","status":"dark","length":472,"sequence":"MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYQLDDPSCPRPECYRSCGSSMPDEFPTDIPGTKGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKERQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQETEVRPGIVSKDSEGKLMCKSIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQILGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD","function_summary":"A cytosolic translational GTPase that forms the GTP-bound core of the initiation heterotrimer, assembling with initiator tRNA to deliver it to the small ribosomal subunit and drive start-site commitment during initiation. Its N-terminal GTPase engine and central beta-barrel scaffold coordinate ternary complex assembly, while the C-terminal region stabilizes factor interactions and cycling. Beyond its central role in initiation, it can associate with adhesion machinery and is frequently found within soluble complexes and extracellular vesicles, consistent with moonlighting interactions that organize cytoplasmic translation hubs.","plain_language":"EIF2S3B has barely been studied. The model's best guess: A cytosolic translational GTPase that forms the GTP-bound core of the initiation heterotrimer, assembling with initiator tRNA to deliver it to the small ribosomal subunit and drive start-site commitment during initiation. Its N-terminal GTPase engine and central beta-barrel scaffold coordinate ternary complex assembly, while the C-terminal region stabilizes factor interactions and cycling.","uniprot_summary":"eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA.","go_terms":{"molecular_function":[{"id":"GO:0045296","label":"cadherin binding"},{"id":"GO:0003743","label":"translation initiation factor activity"},{"id":"GO:0003924","label":"GTPase activity"}],"biological_process":[{"id":"GO:0006413","label":"translational initiation"}],"cellular_component":[{"id":"GO:0032991","label":"protein-containing complex"},{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0070062","label":"extracellular exosome"}]},"interpro":[{"id":"IPR027417","name":"P-loop containing nucleoside triphosphate hydrolase","type":"homologous_superfamily","start":33,"end":252},{"id":"IPR009000","name":"Translation protein, beta-barrel domain superfamily","type":"homologous_superfamily","start":248,"end":362},{"id":"IPR009001","name":"Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal","type":"homologous_superfamily","start":364,"end":460},{"id":"IPR000795","name":"Translational (tr)-type GTP-binding domain","type":"domain","start":39,"end":248},{"id":"IPR044128","name":"Initiation factor eIF2 gamma, GTP-binding domain","type":"domain","start":42,"end":248},{"id":"IPR044127","name":"Initiation factor eIF2 gamma, domain 2","type":"domain","start":249,"end":362},{"id":"IPR004161","name":"Translation elongation factor EFTu-like, domain 2","type":"domain","start":276,"end":358},{"id":"IPR015256","name":"Initiation factor eIF2 gamma, C-terminal","type":"domain","start":365,"end":459},{"id":"IPR050543","name":"Eukaryotic Initiation Factor 2 Gamma Subunit","type":"family","start":14,"end":468}],"reasoning":"I begin by dissecting the InterPro architecture and its order along the polypeptide. The N-terminal two-thirds (residues 33–252) are covered by IPR027417 (P-loop containing nucleoside triphosphate hydrolase homologous superfamily), which establishes a classical NTPase core. Within this region, IPR000795 (Translational-type GTP-binding domain, residues 39–248) and IPR044128 (Initiation factor eIF2 gamma, GTP-binding domain, residues 42–248) define a translational GTPase module that binds and hydrolyzes GTP. This GTPase core is followed by a contiguous mid-region comprising IPR009000 (Translation protein, beta-barrel domain superfamily, residues 248–362), IPR044127 (Initiation factor eIF2 gamma, domain 2, residues 249–362), and IPR004161 (Translation elongation factor EF-Tu-like, domain 2, residues 276–358). This beta-barrel “domain II” scaffold is characteristic of translational GTPases and positions the GTPase core relative to RNA- and protein-interaction surfaces. The C-terminal third is defined by IPR009001 (Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal homologous superfamily, residues 364–460) and IPR015256 (Initiation factor eIF2 gamma, C-terminal domain, residues 365–459), which together form the eIF2γ tail that stabilizes ternary complex assembly and heterotrimer formation. The entire sequence is encompassed by IPR050543 (Eukaryotic Initiation Factor 2 Gamma Subunit family, residues 14–468), confirming the identity and modular arrangement of an initiation-factor GTPase.\n\nThis ordered architecture causes a specific molecular function profile. The P-loop NTPase core and translational GTPase domains (IPR000795, IPR044128) directly encode GO:0003924 GTPase activity. The EF-Tu/eIF2γ domain II and C-terminal modules (IPR009000, IPR044127, IPR004161, IPR009001, IPR015256) create the composite surface that binds initiator tRNA and partner subunits, thereby producing GO:0003743 translation initiation factor activity. The presence of adhesion-related binding capacity is supported by the extended C-terminal region and beta-barrel scaffold that often mediates auxiliary protein contacts; this provides a structural basis for GO:0045296 cadherin binding, consistent with moonlighting roles of cytosolic translation factors at adherens junctions.\n\nFrom these molecular activities, the biological process follows. The GTP-driven assembly of the ternary complex with initiator tRNA and the subsequent hydrolysis-triggered release are the defining steps of GO:0006413 translational initiation. The domain layout that stabilizes the eIF2 heterotrimer and coordinates with the small ribosomal subunit ensures accurate start-site selection and delivery of the initiator tRNA.\n\nCellular localization is inferred from function and composition. The soluble, multi-domain scaffold lacks transmembrane segments and is optimized for ribosome-proximal cytosolic action, supporting GO:0005829 cytosol and the broader cytoplasmic milieu. Its participation in large initiation assemblies places it within GO:0032991 protein-containing complex. Detection in extracellular vesicles is consistent with the stability and moonlighting interactions of cytosolic factors that can be packaged into GO:0070062 extracellular exosome.\n\nMechanistically, the N-terminal GTPase core binds GTP and forms a ternary complex with initiator tRNA; the mid beta-barrel domain II positions the complex for ribosome engagement; and the C-terminal region stabilizes eIF2 heterotrimer formation and coordinates factor cycling. Hydrolysis of GTP on this translational GTPase triggers conformational changes that release initiator tRNA into the P site, committing the ribosome to initiation. The cadherin-binding capacity suggests transient junctional associations that could spatially organize initiation near adhesion sites. I therefore hypothesize interactions with the other eIF2 subunits (alpha and beta), the small ribosomal subunit, initiator tRNA, and auxiliary initiation factors; cadherin complexes may provide additional docking surfaces that tune localized translation in human cells.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q2VIR3.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q2VIR3"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q2VIR3/entry","atlas":"/p/Q2VIR3"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}