{"uniprot":"Q30KQ5","gene":"DEFB115","name":"Beta-defensin 115","organism":"Homo sapiens (Human)","status":"dark","length":88,"sequence":"MLPDHFSPLSGDIKLSVLALVVLVVLAQTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQKETSELYI","function_summary":"A secreted human β-defensin that deploys a cystine-stabilized antimicrobial scaffold to neutralize microbes in the extracellular milieu. By binding and clustering on bacterial envelopes, it disrupts membrane integrity and contributes broadly to antibacterial defense. Its soluble, oligomerization-prone architecture also enables multivalent interactions with host factors, positioning it as an extracellular innate immune effector that acts against both Gram-negative and Gram-positive bacteria.","plain_language":"DEFB115 has barely been studied. The model's best guess: A secreted human β-defensin that deploys a cystine-stabilized antimicrobial scaffold to neutralize microbes in the extracellular milieu. By binding and clustering on bacterial envelopes, it disrupts membrane integrity and contributes broadly to antibacterial defense.","uniprot_summary":"May have broad-spectrum activity.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0050829","label":"defense response to Gram-negative bacterium"},{"id":"GO:0050830","label":"defense response to Gram-positive bacterium"}],"cellular_component":[{"id":"GO:0005615","label":"extracellular space"}]},"interpro":[{"id":"IPR025933","name":"Beta-defensin domain","type":"domain","start":37,"end":66}],"reasoning":"I begin with the InterPro architecture: a single IPR025933 Beta-defensin domain (residues 37–66). This compact cysteine-rich module encodes the canonical β-defensin fold—a cystine-stabilized β-sheet that forms a disulfide-bonded, amphipathic scaffold. Placement of the defensin domain in the C-terminal half implies an N-terminal signal peptide and prodomain preceding secretion, a common defensin architecture that causes extracellular deployment and maturation. The β-defensin fold creates a cationic, hydrophobic surface that binds anionic bacterial envelope components and other host factors; this structural chemistry underlies broad-spectrum antimicrobial action and multivalent protein interactions.\n\nFrom this defensin core, I infer molecular function as protein binding (GO:0005515). The β-defensin scaffold is not an enzyme; rather, it achieves activity through high-affinity binding to microbial membranes, endotoxin, and host proteins. The disulfide-stabilized β-sheet confers rigidity and oligomerization propensity, enabling avid binding and membrane disruption that underpins defensin cytotoxicity.\n\nThis binding-driven mechanism naturally extends to defense response against diverse bacteria. The cationic defensin surface targets Gram-negative outer membranes and Gram-positive peptidoglycan/cell wall matrices, supporting defense response to Gram-negative bacterium (GO:0050829) and defense response to Gram-positive bacterium (GO:0050830). The same architecture explains the observed activity spectrum and synergy with other innate effectors.\n\nCellular localization follows directly from the signal-peptide/prodomain logic and the defensin fold’s extracellular role: the protein is secreted and operates in the extracellular space (GO:0005615). The stated secreted nature is consistent with the defensin family’s extracellular deployment where pathogens are encountered.\n\nMechanistically, I hypothesize that the defensin domain oligomerizes upon contacting bacterial surfaces, transiently forming membrane-disruptive assemblies that permeabilize target envelopes. As a soluble immune modulator, it likely binds host proteins that shape antimicrobial efficacy and inflammatory tone. In this context, plausible interaction partners include extracellular matrix components and soluble mediators that tune antimicrobial and immunomodulatory outcomes. I therefore anticipate transient complexes with heparan sulfate proteoglycans and cytokine/chemokine milieus that concentrate and regulate defensin activity at mucosal and epithelial interfaces.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q30KQ5.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q30KQ5"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q30KQ5/entry","atlas":"/p/Q30KQ5"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}