{"uniprot":"Q3KNT7","gene":"NSUN5P1","name":"Putative NOL1/NOP2/Sun domain family member 5B","organism":"Homo sapiens (Human)","status":"dark","length":163,"sequence":"MATLLAWVGVSCCELAEEDFLAVSPLDPRYREVHYVLLDPSCSGSGMPSRQLEDPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSMCSLCQEENEDMVPDALQQNPGAFRLAPALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPT","function_summary":"A soluble nuclear RNA-modifying enzyme that uses S-adenosylmethionine to install 5-methylcytidine on structured RNA, targeting both ribosomal RNA and tRNA. By binding and methylating cytosine within rRNA and tRNA, it promotes ribosome assembly and stability and enhances translational capacity. Its activity occurs in the nucleoplasm, where preribosomal particles and tRNA-processing pathways concentrate, and the catalytic mechanism proceeds through a transient covalent intermediate typical of cytosine C5 methyltransferases.","plain_language":"NSUN5P1 has barely been studied. The model's best guess: A soluble nuclear RNA-modifying enzyme that uses S-adenosylmethionine to install 5-methylcytidine on structured RNA, targeting both ribosomal RNA and tRNA. By binding and methylating cytosine within rRNA and tRNA, it promotes ribosome assembly and stability and enhances translational capacity.","uniprot_summary":"Involved in ribosome biogenesis. S-adenosyl-L-methionine-dependent methyltransferase that specifically methylates the C(5) position of cytosine 389 in 18S ribosomal RNA and confers ribosome protective properties.","go_terms":{"molecular_function":[{"id":"GO:0000049","label":"tRNA binding"},{"id":"GO:0016427","label":"tRNA (cytosine) methyltransferase activity"}],"biological_process":[{"id":"GO:0045727","label":"positive regulation of translation"},{"id":"GO:0070475","label":"rRNA base methylation"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR029063","name":"S-adenosyl-L-methionine-dependent methyltransferase superfamily","type":"homologous_superfamily","start":1,"end":162},{"id":"IPR001678","name":"SAM-dependent methyltransferase RsmB-F/NOP2-type domain","type":"domain","start":1,"end":159},{"id":"IPR049560","name":"SAM-dependent methyltransferase RsmB-F/NOP2-type, catalytic core","type":"domain","start":33,"end":155},{"id":"IPR023267","name":"RNA (C5-cytosine) methyltransferase","type":"family","start":3,"end":158}],"reasoning":"I begin with the InterPro architecture. The polypeptide is entirely covered by IPR029063 (S-adenosyl-L-methionine-dependent methyltransferase superfamily, residues 1–162), establishing a class I SAM-dependent methyltransferase scaffold. Nested within this scaffold is IPR001678 (SAM-dependent methyltransferase RsmB-F/NOP2-type domain, residues 1–159), which defines the catalytic lineage that modifies cytidine in structured RNAs. The catalytic heart is further pinpointed by IPR049560 (RsmB-F/NOP2-type catalytic core, residues 33–155), indicating the conserved active-site geometry that binds SAM and forms a transient covalent adduct during C5-methyl transfer. Finally, IPR023267 (RNA [C5-cytosine] methyltransferase family, residues 3–158) assigns the chemistry to cytosine C5 methylation on RNA. The ordered layout—superfamily envelope, NOP2-type catalytic domain, and a sharply delimited catalytic core—causes a SAM-dependent RNA cytidine methyltransferase activity with high specificity for structured RNA substrates.\n\nThis NOP2-type architecture dictates molecular function. The RsmB-F/NOP2 fold binds SAM and catalyzes electrophilic substitution at cytosine C5, a mechanism characteristic of RNA C5-cytosine methyltransferases. Such enzymes require precise RNA recognition; the NOP2 lineage is well known for acting on structured RNAs, often rRNA and tRNA. This directly supports GO:0016427 tRNA (cytosine) methyltransferase activity and GO:0000049 tRNA binding, because the fold and catalytic chemistry necessitate stable tRNA engagement to position cytidine for modification. The same catalytic logic extends to rRNA substrates, where the enzyme’s RNA-binding surfaces and catalytic core enable site-specific methylation.\n\nFrom these molecular activities, the biological processes follow. The catalytic core that installs 5-methylcytidine on rRNA anchors the role in GO:0070475 rRNA base methylation. Installing m5C marks contributes to ribosome biogenesis and stability, which causally enhances translational capacity—consistent with GO:0045727 positive regulation of translation. The enzyme’s dual targeting of tRNA and rRNA integrates RNA modification with the broader pathway of ribosome assembly and function.\n\nCellular location is inferred from where these RNA substrates are processed and where the modification impacts ribosome production. rRNA transcription and early processing occur in the nucleus, particularly within the nucleoplasm where preribosomal particles assemble. The soluble, non-membranous architecture and the need to access nascent ribosomal RNA point to a nuclear interior localization, aligning with GO:0005654 nucleoplasm.\n\nMechanistically, the enzyme binds SAM and engages structured tRNA and rRNA via the NOP2-type RNA-binding groove. It forms a covalent intermediate at cytosine C5, transfers a methyl group from SAM, and releases m5C-marked RNA. This modification tunes ribosome assembly and tRNA performance, thereby elevating translational throughput. Likely interaction partners include nucleolar and nucleoplasmic ribosome biogenesis factors that present rRNA substrates (e.g., core nucleolar proteins and preribosomal assembly factors), as well as tRNA maturation machinery. These assemblies would transiently recruit the enzyme to preribosomal complexes and tRNA-processing hubs, ensuring efficient, site-specific methylation that feeds forward into robust translation.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q3KNT7.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q3KNT7"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q3KNT7/entry","atlas":"/p/Q3KNT7"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}