{"uniprot":"Q494R0","gene":"FBXL19-AS1","name":"Putative uncharacterized protein FBXL19-AS1","organism":"Homo sapiens (Human)","status":"dark","length":122,"sequence":"MAEPGGRGDYRKDGRLPSLSRSPLSTTLGTSPACGLEIPPTSGARPDGSCSLPAPVYHLKSRQWKGMGRGYRQRWRLQGRGDCDMGCVVQASGLFPAEMRERTTKKMATSPLDLCAGACWEM","function_summary":"A nuclear, nuclear-body–associated regulator that uses multivalent protein binding to assemble and stabilize transcriptional repression assemblies. By concentrating corepressor and chromatin-modifying activities within nuclear condensates, it dampens RNA polymerase II–driven gene expression. Its mechanism is scaffold-like: a binding-centric architecture organizes silencing complexes in nuclear bodies to modulate promoter-proximal environments and enforce transcriptional repression.","plain_language":"FBXL19-AS1 has barely been studied. The model's best guess: A nuclear, nuclear-body–associated regulator that uses multivalent protein binding to assemble and stabilize transcriptional repression assemblies. By concentrating corepressor and chromatin-modifying activities within nuclear condensates, it dampens RNA polymerase II–driven gene expression.","uniprot_summary":"May be involved in transcriptional regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0000122","label":"negative regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0016604","label":"nuclear body"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The presence of only a generic protein-binding signature and no catalytic or DNA/RNA-binding domains indicates a non-enzymatic regulator that operates through multivalent interactions. Such architectures typically function as transcriptional modulators that assemble or disrupt repressive complexes rather than directly modifying substrates.\n\nFrom this binding-centric core, the most direct molecular function is protein binding (GO:0005515). A binding-only scaffold can nucleate assemblies that silence transcription. This causal role aligns with negative regulation of transcription by RNA polymerase II (GO:0000122): by recruiting or stabilizing corepressor machinery, the protein reduces Pol II-driven gene expression. The biological logic is that a non-DNA-binding regulator achieves repression by altering chromatin-associated complexes and promoter-proximal environments.\n\nCellular context sharpens the model. Localization to nuclear bodies (GO:0016604) places the protein in membraneless nuclear condensates such as PML bodies or related transcriptional hubs. Nuclear bodies concentrate SUMOylation pathways and transcriptional repressors; a binding-driven regulator situated here can efficiently gate access to chromatin and Pol II machinery. The broader subcellular location is nuclear, consistent with transcriptional control and consistent with the experimentally observed nuclear residency.\n\nMechanistically, a nuclear-body-tethered binding scaffold can repress transcription by two coupled routes: (1) assembling corepressor complexes that deacetylate or otherwise remodel chromatin, and (2) modulating the availability and dynamics of RNA polymerase II and its cofactors within nuclear condensates. The absence of enzymatic domains and the presence of nuclear-body residence together argue that repression is executed through avid protein–protein interactions that concentrate and stabilize silencing assemblies.\n\nThis architecture and localization suggest specific partners. In nuclear bodies, SUMO pathway components and PML-scaffolded assemblies are prime candidates. To enact Pol II repression, the protein likely engages corepressors and chromatin modifiers (e.g., HDAC-containing complexes) and transiently contacts Pol II-associated factors. I therefore hypothesize interactions with PML-body residents and transcriptional repressors that together enforce a silenced chromatin state and dampen Pol II output.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q494R0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q494R0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q494R0/entry","atlas":"/p/Q494R0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}