{"uniprot":"Q4G0N0","gene":"GGTA1P","name":"Inactive N-acetyllactosaminide alpha-1,3-galactosyltransferase","organism":"Homo sapiens (Human)","status":"dark","length":100,"sequence":"MNVKGKVILSMLVVSTVIIVFWEFINSTEGSFLWIYHSKNPEVDDSSAQKGWWFLSWFNNGIHNYQQGEEDIDKEKGREETKGRKMTQQSFGYGTGLIQT","function_summary":"A Golgi-anchored, single-pass type II membrane regulator that uses multivalent protein binding to assemble and position signaling-modulatory complexes. By organizing trafficking and sorting assemblies at the Golgi, it dampens bone morphogenetic protein signaling—likely by sequestering or routing pathway receptors and modulators away from productive signaling sites, thereby attenuating downstream transcriptional responses.","plain_language":"GGTA1P has barely been studied. The model's best guess: A Golgi-anchored, single-pass type II membrane regulator that uses multivalent protein binding to assemble and position signaling-modulatory complexes. By organizing trafficking and sorting assemblies at the Golgi, it dampens bone morphogenetic protein signaling—likely by sequestering or routing pathway receptors and modulators away from productive signaling sites, thereby attenuating downstream transcriptional responses.","uniprot_summary":"Involved in bone morphogenetic protein (BMP) signaling.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0030514","label":"negative regulation of BMP signaling pathway"}],"cellular_component":[{"id":"GO:0005794","label":"Golgi apparatus"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated feature: GO:0005515 protein binding as a core molecular function. The absence of catalytic InterPro domains and the presence of a binding-centric annotation indicate a non-enzymatic regulator that operates through selective protein–protein interactions. The subcellular annotation describes a single-pass type II membrane topology at the Golgi apparatus membrane. Type II topology places a short N-terminal cytosolic tail followed by a transmembrane helix and a large luminal/extracytoplasmic domain. This architecture causes the cytosolic tail to serve as a localization and sorting module (often via basic clusters and phosphorylation sites), while the luminal domain can engage cargo or matrix components within the Golgi cisternae. Together, a binding-centric module tethered as a single-pass membrane protein at the Golgi establishes a scaffold that organizes signaling and trafficking assemblies.\n\nFrom this architecture, the molecular function resolves as protein binding (GO:0005515): the cytosolic tail and luminal domain provide multivalent interfaces that assemble regulatory complexes rather than catalyzing reactions. The biological role follows from how such Golgi-tethered scaffolds tune receptor and morphogen pathways. Negative regulation of the BMP signaling pathway (GO:0030514) is parsimoniously explained by Golgi-centered control points: by sequestering, sorting, or desensitizing BMP pathway components (e.g., BMP receptors and SMAD modulators), the protein dampens pathway throughput. A type II Golgi membrane anchor can inhibit signaling by retaining receptors in the secretory pathway, biasing their routing toward endocytic or degradative routes, or stabilizing inhibitory complexes that limit receptor availability at the cell surface.\n\nCellular localization is anchored by two convergent lines: the explicit Golgi apparatus assignment (GO:0005794) and the single-pass type II membrane topology that dictates membrane residency. This positioning is causal—Golgi localization enables the protein to intercept and regulate membrane-proximal signaling assemblies and cargo trafficking streams that feed BMP signaling.\n\nMechanistically, I hypothesize that the cytosolic N-terminus recruits endocytic and Golgi-sorting machinery (e.g., AP complexes and clathrin adaptors), while the luminal region binds cargo or matrix, thereby concentrating BMP pathway regulators in Golgi subdomains. By assembling inhibitory complexes and routing BMP receptors away from productive signaling locales, the protein attenuates SMAD activation. Likely interaction partners include BMP receptors and their adaptors at the Golgi–endosome interface, as well as coat and tethering systems that enforce pathway suppression.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q4G0N0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q4G0N0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q4G0N0/entry","atlas":"/p/Q4G0N0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}