{"uniprot":"Q4QY38","gene":"DEFB134","name":"Beta-defensin 134","organism":"Homo sapiens (Human)","status":"dark","length":66,"sequence":"MKPLLVVFVFLFLWDPVLAGINSLSSEMHKKCYKNGICRLECYESEMLVAYCMFQLECCVKGNPAP","function_summary":"A secreted human antimicrobial effector that is synthesized through the secretory pathway and released to the extracellular milieu, where a disulfide-stabilized defensin fold binds bacterial envelope components and disrupts membranes. By targeting lipopolysaccharide-rich surfaces, it exerts broad-spectrum antimicrobial activity and simultaneously shapes innate immune responses. Its chemotactic properties attract monocytes and other leukocytes, coordinating pathogen clearance and inflammatory signaling.","plain_language":"DEFB134 has barely been studied. The model's best guess: A secreted human antimicrobial effector that is synthesized through the secretory pathway and released to the extracellular milieu, where a disulfide-stabilized defensin fold binds bacterial envelope components and disrupts membranes. By targeting lipopolysaccharide-rich surfaces, it exerts broad-spectrum antimicrobial activity and simultaneously shapes innate immune responses.","uniprot_summary":"Has antimicrobial activity against Gram-positive and Gram-negative bacteria.","go_terms":{"molecular_function":[{"id":"GO:0001530","label":"lipopolysaccharide binding"}],"biological_process":[{"id":"GO:0045087","label":"innate immune response"},{"id":"GO:0002548","label":"monocyte chemotaxis"},{"id":"GO:0050918","label":"positive chemotaxis"},{"id":"GO:1901655","label":"cellular response to ketone"}],"cellular_component":[{"id":"GO:0005615","label":"extracellular space"},{"id":"GO:0005796","label":"Golgi lumen"}]},"interpro":[{"id":"IPR025933","name":"Beta-defensin domain","type":"domain","start":31,"end":59}],"reasoning":"I begin with the InterPro architecture: a single IPR025933 Beta-defensin domain (residues 31–59). This compact cysteine-rich module encodes a β-defensin fold stabilized by disulfide bonds and typically preceded by an N-terminal signal peptide that directs secretion. The solitary β-defensin core and absence of additional catalytic domains indicate a non-enzymatic, secreted antimicrobial effector whose activity arises from high-affinity binding and membrane-disruptive properties rather than enzymatic turnover.\n\nThis defensin architecture causally explains lipid-polysaccharide recognition. The β-defensin fold presents a cationic, amphipathic surface that avidly binds anionic bacterial envelope components, particularly lipopolysaccharide. That physical chemistry underlies GO:0001530 lipopolysaccharide binding and provides the molecular basis for antimicrobial action against both Gram-negative and Gram-positive bacteria.\n\nFrom this molecular function, the biological roles follow. Lipopolysaccharide binding and membrane perturbation are canonical features of innate immune effectors, placing the protein squarely in GO:0045087 innate immune response. Chemotactic effects on monocytes are a well-documented outcome of defensin-mediated signaling and chemokine mimicry; thus the same architecture that binds microbial ligands also shapes leukocyte trafficking, supporting GO:0002548 monocyte chemotaxis and GO:0050918 positive chemotaxis. The responsiveness to menadione (GO:1901655 cellular response to ketone) is consistent with oxidative stress signaling often triggered downstream of defensin exposure and membrane perturbation.\n\nCellular location is dictated by the signal peptide and secretory pathway. The β-defensin domain’s secretory bias, together with the need to encounter pathogens and leukocytes outside the cell, points to extracellular deployment. Transit through the secretory pathway rationalizes accumulation in the GO:0005796 Golgi lumen before release. The final operating site is the GO:0005615 extracellular space, aligning with a secreted effector that binds microbial surfaces and modulates immune cell behavior.\n\nMechanistically, I hypothesize that the protein is synthesized with a signal peptide, folded and disulfide-bonded in the ER/Golgi, and secreted to the extracellular milieu where its β-defensin domain binds lipopolysaccharide and other anionic lipids. This binding concentrates the peptide on bacterial envelopes, where oligomerization and local membrane destabilization produce antimicrobial effects. In parallel, the defensin surface likely engages host receptors or extracellular matrix components to generate chemotactic gradients that attract monocytes and other leukocytes. Likely interaction partners include bacterial LPS and LTA, host scavenger receptors and glycosaminoglycans that concentrate the peptide at inflammatory sites, and secretory pathway chaperones that assist folding and trafficking.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q4QY38.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q4QY38"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q4QY38/entry","atlas":"/p/Q4QY38"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}