{"uniprot":"Q53S08","gene":"RAB6D","name":"Ras-related protein Rab-6D","organism":"Homo sapiens (Human)","status":"dark","length":254,"sequence":"MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDGTIGLRLWDTAGQERLRSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTEGGSDVIITLVGNKTDLADKRQVSIEEGERKAKGLNVTFIETRAKAGYNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQTVSEGGCSCYSPMSSSTLPQKPPYSFIDCSVNIGLNLFPSLITFCNSSLLPVSWR","function_summary":"A human small GTPase that cycles between GTP- and GDP-bound states to control membrane trafficking at the Golgi and associated pathways. By recruiting effectors when GTP-loaded and releasing them when hydrolyzing GTP, it organizes vesicle budding, tethering, and fusion that feed signaling and cargo sorting. This trafficking hub influences centrosome duplication and mitotic progression and contributes to cellular responses to xenobiotic stress. The protein operates between cytosolic and membrane-associated pools, concentrating at the Golgi and near the centrosome to coordinate organelle-directed transport with cell-cycle and stress-responsive pathways.","plain_language":"RAB6D has barely been studied. The model's best guess: A human small GTPase that cycles between GTP- and GDP-bound states to control membrane trafficking at the Golgi and associated pathways. By recruiting effectors when GTP-loaded and releasing them when hydrolyzing GTP, it organizes vesicle budding, tethering, and fusion that feed signaling and cargo sorting.","uniprot_summary":"Small GTPase which cycles between active and inactive states.","go_terms":{"molecular_function":[{"id":"GO:0003924","label":"GTPase activity"},{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007264","label":"small GTPase mediated signal transduction"},{"id":"GO:0000278","label":"mitotic cell cycle"},{"id":"GO:0010824","label":"regulation of centrosome duplication"},{"id":"GO:0009410","label":"response to xenobiotic stimulus"}],"cellular_component":[{"id":"GO:0005794","label":"Golgi apparatus"},{"id":"GO:0005813","label":"centrosome"},{"id":"GO:0005737","label":"cytoplasm"}]},"interpro":[{"id":"IPR027417","name":"P-loop containing nucleoside triphosphate hydrolase","type":"homologous_superfamily","start":11,"end":208},{"id":"IPR005225","name":"Small GTP-binding domain","type":"domain","start":13,"end":169},{"id":"IPR001806","name":"Small GTPase","type":"family","start":9,"end":249},{"id":"IPR050227","name":"Ras-related protein Rab","type":"family","start":13,"end":186}],"reasoning":"I begin with the InterPro architecture. The core of the protein is a P-loop NTPase engine: IPR027417 (P-loop containing nucleoside triphosphate hydrolase homologous superfamily, residues 11–208) provides the Walker A/B phosphate-binding fold that binds and hydrolyzes nucleoside triphosphates. Nested within this engine is IPR005225 (Small GTP-binding domain, residues 13–169), which defines the canonical small GTPase switch module that toggles between GTP- and GDP-bound conformations. The broader family signatures IPR001806 (Small GTPase family, residues 9–249) and IPR050227 (Ras-related protein Rab family, residues 13–186) specify that this switch belongs to the Rab branch of the Ras superfamily. The ordered layout—Rab-family determinants embedded in a small GTP-binding core within a P-loop NTPase scaffold—causes a regulated GTP hydrolysis cycle that gates effector recruitment and membrane trafficking. This architecture directly encodes GO:0003924 GTPase activity and supports multivalent GO:0005515 protein binding through switch I/II-dependent effector interfaces.\n\nFrom this molecular function, I infer the biological processes. Rab-family GTPases orchestrate vesicle formation, motility, tethering, and fusion—events that constitute GO:0007264 small GTPase mediated signal transduction. By directing membrane traffic at the Golgi and endosomal interfaces, the switch controls signaling flux and cargo sorting that feed into cell-cycle checkpoints. This trafficking control provides a mechanistic route to GO:0000278 mitotic cell cycle and GO:0010824 regulation of centrosome duplication: Golgi- and endosome-derived signals and membrane supply modulate centrosome biogenesis and spindle assembly. The same trafficking axis can tune responses to chemical stressors by rerouting receptors and transporters, aligning with GO:0009410 response to xenobiotic stimulus.\n\nCellular location follows from Rab identity and membrane-association logic. Rab-family proteins are soluble cytosolic factors that reversibly dock to membranes via C-terminal prenylation and escort complexes. The trafficking hub they regulate is the Golgi apparatus, supporting GO:0005794 Golgi apparatus. Their influence on centrosome duplication and spindle-related pathways places them at or near the microtubule-organizing center, consistent with GO:0005813 centrosome. The soluble pool and trafficking itinerary also situate the protein broadly in the cytoplasm (GO:0005737 cytoplasm), where nucleotide exchange and effector assembly occur before membrane engagement.\n\nMechanistically, the protein cycles between GDP- and GTP-bound states. In its active, GTP-loaded form it recruits effectors that drive vesicle budding and tethering at the Golgi and endosomal compartments; in its inactive, GDP-loaded form it releases them. This switch likely coordinates Golgi-to-endosome and recycling pathways that feed signaling and cell-cycle machinery. I hypothesize that its effectors include membrane tethers and adaptors that couple Golgi export to endosomal sorting, and that its upstream regulators (GEFs, GAPs, and GDIs) choreograph localization to the Golgi and centrosome. Through these assemblies, the GTPase modulates centrosome duplication timing and xenobiotic-responsive trafficking routes that fine-tune cellular stress responses.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q53S08.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q53S08"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q53S08/entry","atlas":"/p/Q53S08"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}